Identifiers and Description

Gene Model Identifier

TTHERM_00426320

Standard Name

SKP1 (Skp1 homolog)

Aliases

PreTt14067 | 47.m00262 | p20

Description

SKP1 SCF ubiquitin ligase complex protein; Skp1 homolog; gene depletion induced telomere elongation; affinity purification enriched for SCF ubiquitin ligase components

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00651 ) BTB/POZ domain
  • ( PF01466 ) Skp1 family, dimerisation domain
  • ( PF03931 ) Skp1 family, tetramerisation domain

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00167.1 2.9985100291019436e-113
Description: suppressor-kinetochore protein 1 (167 aa)
Oxytricha Contig20929.0.g68 2.000597631390999e-64
Description: Skp1 family, dimerisation domain
DictyBase DDB_G0269230 9.000941515806455e-45
Description: fpaA on chromosome: 1 position 3989908 to 3990396
WormBase WBGene00004807 2.00017271388466e-38
Description: locus:skr-1 status:Confirmed UniProt:G5ECU1 protein_id:CAB03110.1
SGD YDR328C 7.002264059090237e-38
Description: SKP1 Evolutionarily conserved kinetochore protein that is part of multiple protein complexes, including the SCF ubiquitin ligase complex, the CBF3 complex that binds centromeric DNA, and the RAVE complex that regulates assembly of the V-ATPase
Stentor Coeruleus SteCoe_6441 3.975449735908647e-31
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17220281: Witkin KL, Prathapam R, Collins K (2007) Positive and negative regulation of Tetrahymena telomerase holoenzyme. Molecular and cellular biology 27(6):2074-83

Sequences

>TTHERM_00426320(coding)
ATGGATAAAGGTTCTACAAAGGTCAAATTATTGTCTCTTGAAAACGAAATTATTGAAGTT
GACGAAGAAGTCGCTAAGAAGTCATAGTTAATTAAAAATATGATTGAAGATACTGGAACT
GAAGATGATATTCCAATTCCAAATGTTAAGAAGGAGATTCTTTTAAAAATTTTAGAGTAC
TGCGAAAAGCACAAAAACGATAACCCACCTGAAATCGAAAAGCCATTAACCACCAGCAAT
TTAAGTGAATTAGTAGATCCATATGATGCTAAATTTATTGATATTGAAAATCTCGAATAA
CTCTTTGAAATTATATTAGCTGCTAACTATCTCGATATAAAATCTCTTCTTGACTTAGCT
TGCGCCAAAGTTGCTACTCTTATCAAGAACAAAACTCCTGATGAAATCAGAAAAACTTTC
AACATTCCTAACGACTTTACCCCTGAAGAAGAAGCTCAAATTAGAGAAGAAAATAAATGG
GCTGAAGAAGCCACTTCTTGA


>TTHERM_00426320(gene)
ATGGATAAAGGTTCTACAAAGGTCAAATTATTGTCTCTTGAAAACGAAATTATTGAAGTA
ATTAATTAGTTTATTGATTGTTCATTCTTTGCTCATAATGAAGCAAGAGCTTTTTGAGAA
TTATTGTTATCATCATTCTGATGAATGATTAATTATTCATTCATTTAATATTTTTAATTA
ATTATAGGTTGACGAAGAAGTCGCTAAGAAGTCATAGTTAATTAAAAATATGATTGAAGG
TAAATTTATTTTATAGCAATAAATAAACAAAAGCAGCATAATAATAAAATATTTTGGTAA
TTTAAAGATACTGGAACTGAAGATGATATTCCAATTCCAAATGTTAAGAAGGAGATTCTT
TTAAAAATTTTAGAGTACTGCGAAAAGCACAAAAACGATAACCCACCTGAAATCGAAAAG
CCATTAACCACCAGCAATTTAAGTGAATTAGTAGATCCATATGATGCTAAATTTATTGAT
ATTGAAAATCTCGAATAACTCTTTGAAATTATATTAGCTGCTAACTATCTCGATATAAAA
TCTCTTCTTGACTTAGCTTGCGCCAAAGTTGCTACTCTTATCAAGAGTAAGATCAGAAAA
TTAAATAGCTTTTTTGTTTGTTTTCTATGCATGCATTTTATTCTATATTAATTTAACTTC
GCAAGAAAAACGACTATTTCATTAATGTTTTTTTGCAAAAATCTAACCAAAATGCATTAT
AAAAAGAGCTACTAAATGCATATTAGTTGACTTTTTCATTAATATATTTACTTATTTTAA
CTTATAATAGACAAAACTCCTGATGAAATCAGAAAAACTTTCAACATTCCTAACGACTTT
ACCCCTGAAGAAGAAGCTCAAATTAGAGAAGAAAATAAATGGGCTGAAGAAGCCACTTCT
TGA


>TTHERM_00426320(protein)
MDKGSTKVKLLSLENEIIEVDEEVAKKSQLIKNMIEDTGTEDDIPIPNVKKEILLKILEY
CEKHKNDNPPEIEKPLTTSNLSELVDPYDAKFIDIENLEQLFEIILAANYLDIKSLLDLA
CAKVATLIKNKTPDEIRKTFNIPNDFTPEEEAQIREENKWAEEATS