Identifiers and Description

Gene Model Identifier

TTHERM_00429890

Standard Name

CNPL1 (Conserved nucleoplasmin like 1)

Aliases

PreTt26429 | 48.m00192 | 3831.m01535 | GTE3

Description

nucleoplasmin protein; Interacts with histone H2A and localizes to MAC. Homolog of human nucleoplasmin 1 (NPM1) (Ashraf et al. 2019).

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04130.1 3.999244945363787e-60
Description: hypothetical protein (351 aa)

General Information

No. Gene Name(s) Paragraph Text
131 CNPL1 NPM-family proteins are H2A/H2B chaperones with important roles in various cellular processes. Vertebrates have three NPM proteins (NPM 1-3) whereas invertebrates contain only a single Npm-like protein. Human NPM1 functions in many processes, including histone chaperoning, chromatin remodeling, transcription regulation, genome stability, apoptosis, and embryogenesis. Tetrahymena CNPL1 shares conserved domain architecture with NPM-family members and is an ortholog of NPM1 protein. CNPL1 co-purified with histone H2A as a high-confidence interacting partner. CNPL1 localizes to MAC during vegetative growth (Ashraf et al. 2019).

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00429890(coding)
ATGTTCTGGGGTTGCACTGTTAAGAAAGGTAACGATCACAAGTTCGAATCTGAAGACCAC
GCTATTTTGCATCTTTCCAATGTTGCTTTGGGTTTAAATACTAAGGCCGGAGCTCAAGCT
TCCGTCTTTGCCAAAGTTGATGGAAAGGAATTCGTCATTACTCACTTGACCTAGGGTAAA
GTTGAACACACTACTCTCGATCTCTATTTTAGAAACGACCAAGAAGTCACTTTCGGTGTT
AAAGGAGAAGCTGAAGTTCACTTGAGTGGTTATTTCGAACCTGATCATGATGAAGAAGAT
CTTTATGATGATTATCCTTATGGCGAAGAAGAATTCGACGACGAAGAAGATGAAGAACTC
GAAGGAGAAGATGATGAAGATGACGATGAAGAGGAAGAAGAAGAAAAGCCTAAGCAACAA
CTCCAAAAGGAAGCTGCTAAGAAGCCAGCTGCCTAACAATAAGCTGCTGCTGCCACTAAA
AAGCCAGCTGAAGTTCAAAAGAAGGCTGAACCTGCTGCCAAGGCTGCTGAAGCAAAGAAG
CAACCTTCCCTTCAAGAAACTTTAGCCTTAAAGGCTGCTGCTGCTGCCAAGGCTAAGGAA
GCTTTGTAAAGTGATGAAGATGATGAAGACGATGATGATATGGATATTGATATGGAAGAT
GATGATGAAGAAGACGATGACGAAGAAGATTTCGATGATGAAGAAGAAGGTAATGATATC
GATGACGATGTTTCTGACTCTGACAATGAAAATGGAACTTTATCTTAAATGTTAAAGAGA
ACTGGTGCTGAATAACACTAAGACTTGAATAAGAAGGCCAAGGCCAACAACAACTAAGCT
GTTAACAAGCCTTAAAACTAAAACTAAAAGCCTTAATAATAAAACTAAAACCAAAAGCAA
AACAACCAACAATAAGGAAAGCCCCAACAATAACAATAAAACCAAAACAAGCAACAACAC
AATAACTAAAACAAGCAAAATCACTAATAACATCAAAACAAGCAAAACTAACATCAAAAC
AAGCAACACAACAACAACTAATAACATCACAACAAGAATTAACACCATCAAAATAAAAAT
CAACACAACAAAAATGCTCACAAAAAGAACTGA


>TTHERM_00429890(gene)
ATGTTCTGGGGTTGCACTGTTAAGAAAGGTAACGATCACAAGTTCGAATCTGAAGACCAC
GCTATTTTGCATCTTTCCAATGTTGCTTTGGGTTTAAATACTAAGGCCGGAGCTCAAGCT
TCCGTCTTTGCCAAAGTTGATGGAAAGGAATTCGTCATTACTCACTTGACCTAGGGTAAA
GTTGAACACACTACTCTCGATCTCTATTTTAGAAACGACCAAGAAGTCACTTTCGGTGTT
AAAGGAGAAGCTGAAGTTCACTTGAGTGGTTATTTCGAACCTGATCATGATGAAGAAGAT
CTTTATGATGATTATCCTTATGGCGAAGAAGAATTCGACGACGAAGAAGATGAAGAACTC
GAAGGAGAAGATGATGAAGATGACGATGAAGAGGAAGAAGAAGAAAAGCCTAAGCAACAA
CTCCAAAAGGAAGCTGCTAAGAAGCCAGCTGCCTAACAATAAGCTGCTGCTGCCACTAAA
AAGCCAGCTGAAGTTCAAAAGAAGGCTGAACCTGCTGCCAAGGCTGCTGAAGCAAAGAAG
CAACCTTCCCTTCAAGAAACTTTAGCCTTAAAGGCTGCTGCTGCTGCCAAGGCTAAGGAA
GCTTTGTAAAGTGATGAAGATGATGAAGACGATGATGATATGGATATTGATATGGAAGAT
GATGATGAAGAAGACGATGACGAAGAAGATTTCGATGATGAAGAAGAAGGTAATGATATC
GATGACGATGTTTCTGACTCTGACAATGAAAATGGAACTTTATCTTAAATGTTAAAGAGA
ACTGGTGCTGAATAACACTAAGACTTGAATAAGAAGGCCAAGGCCAACAACAACTAAGCT
GTTAACAAGCCTTAAAACTAAAACTAAAAGCCTTAATAATAAAACTAAAACCAAAAGCAA
AACAACCAACAATAAGGAAAGCCCCAACAATAACAATAAAACCAAAACAAGCAACAACAC
AATAACTAAAACAAGCAAAATCACTAATAACATCAAAACAAGCAAAACTAACATCAAAAC
AAGCAACACAACAACAACTAATAACATCACAACAAGAATTAACACCATCAAAATAAAAAT
CAACACAACAAAAATGCTCACAAAAAGAACTGA


>TTHERM_00429890(protein)
MFWGCTVKKGNDHKFESEDHAILHLSNVALGLNTKAGAQASVFAKVDGKEFVITHLTQGK
VEHTTLDLYFRNDQEVTFGVKGEAEVHLSGYFEPDHDEEDLYDDYPYGEEEFDDEEDEEL
EGEDDEDDDEEEEEEKPKQQLQKEAAKKPAAQQQAAAATKKPAEVQKKAEPAAKAAEAKK
QPSLQETLALKAAAAAKAKEALQSDEDDEDDDDMDIDMEDDDEEDDDEEDFDDEEEGNDI
DDDVSDSDNENGTLSQMLKRTGAEQHQDLNKKAKANNNQAVNKPQNQNQKPQQQNQNQKQ
NNQQQGKPQQQQQNQNKQQHNNQNKQNHQQHQNKQNQHQNKQHNNNQQHHNKNQHHQNKN
QHNKNAHKKN