Identifiers and Description

Gene Model Identifier

TTHERM_00431230

Standard Name

RAB53 (RAB GTPase 53)

Aliases

PreTt26464 | 48.m00227 | 3831.m01567

Description

RAB53 small guanosine triphosphatase family Ras family protein; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04156.1 1.999002769139511e-37
Description: hypothetical protein (347 aa)
WormBase WBGene00016344 3.9983110956465888e-22
Description: locus:tag-312 Ras and EF-hand domain-containing protein homolog status:Partially_confirmed UniProt:Q22908 protein_id:CCD66473.1
Oxytricha Contig9955.0.g63 2.0002795641672355e-21
Description: Ras family
SGD YFL038C 4.999245259173412e-21
Description: YPT1 Rab family GTPase, involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by protein geranylgeranyltransferase type II (Bet2p-Bet4p)
DictyBase DDB_G0276399 1.9991095569230066e-20
Description: rab8B on chromosome: 2 position 6878753 to 6879364
Stentor Coeruleus SteCoe_24985 0.0000000001026187963170189
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00431230(coding)
ATGAGTCATATTTAAATGAATTAAAATGAATCTAATTAAAAGAAAAATATGAAAATATCA
ATTATGATATGCGGCAACTAAGCAGTAGGAAAAACTTCAATAATTGGATATTATATCAAT
GGTTCCTTTAAAAATAAGTATAATGTTACCCCATAGTGTGAATATAGCATAAAAAATGAA
ACCATTGATTAAGAAAATGTTAATGTTTAAATGATAGATGCACCTGGAATGCTAAATGTA
ATTGATATAACAAGACAACAAATTAGGTCAGCTGATGGATATATATTTGTTTATGATATT
TATGATCACGAATCATTTAAGAATATTGATATATGGGTATAATAGATCTAATAACATAAG
AGTGAGTTCGAAAAGTGTAAGTGCTTGCTAATTGGAAATAAGGTAGATACAAGGAAAAAT
CCTTCTGAAGGTATTAGCTATGAAAAAGGTTAGGAGAAAGCAAAAAACTTTAATATGAAT
TTCTTTGAAACATCAGCTAAAGAAGGAACAAGTATAGTAAGTGCTATTAGAGGTTTAGCA
ATTAATATTTATCACTAAAAAAAGGATTGTATTTTAAAGTAATAGAATATCTTACAGGAG
TAATAAAAAATATCAGGGAGCTCAAATGATTTAAATATTGATGAAAAATTCTTACTCAAT
AATAGTAGAAATCGATAGCCTAAAAAAAATTGTTGGTAGAAATTTAAATCTTGTTTTTGA


>TTHERM_00431230(gene)
ATGAGTCATATTTAAATGAATTAAAATGAATCTAATTAAAAGAAAAATATGAAAATATCA
ATTATGATATGCGGCAACTAAGCAGTAGGAAAAACTTCAATAATTGGATATTATATCAAT
GGTTCCTTTAAAAATAAGTATAATGTTACCCCATAGTGTGAATATAGCATAAAAAATGAA
ACCATTGATTAAGAAAATGTTAATGTTTAAATGATAGATGCACCTGGAATGCTAAATGTA
ATTGATATAACAAGACAACAAATTAGGTCAGCTGATGGATATATATTTGTTTATGATATT
TATGATCACGAATCATTTAAGAATATTGATATATGGGTATAATAGATCTAATAACATAAG
AGTGAGTTCGAAAAGTGTAAGTGCTTGCTAATTGGAAATAAGGTAGATACAAGGAAAAAT
CCTTCTGAAGGTATTAGCTATGAAAAAGGTTAGGAGAAAGCAAAAAACTTTAATATGAAT
TTCTTTGAAACATCAGCTAAAGAAGGAACAAGTATAGTAAGTGCTATTAGAGGTTTAGCA
ATTAATATTTATCACTAAAAAAAGGATTGTATTTTAAAGTAATAGAATATCTTACAGGAG
TAATAAAAAATATCAGGGAGCTCAAATGATTTAAATATTGATGAAAAATTCTTACTCAAT
AATAGTAGAAATCGATAGCCTAAAAAAAATTGTTGGTAGAAATTTAAATCTTGTTTTTGA


>TTHERM_00431230(protein)
MSHIQMNQNESNQKKNMKISIMICGNQAVGKTSIIGYYINGSFKNKYNVTPQCEYSIKNE
TIDQENVNVQMIDAPGMLNVIDITRQQIRSADGYIFVYDIYDHESFKNIDIWVQQIQQHK
SEFEKCKCLLIGNKVDTRKNPSEGISYEKGQEKAKNFNMNFFETSAKEGTSIVSAIRGLA
INIYHQKKDCILKQQNILQEQQKISGSSNDLNIDEKFLLNNSRNRQPKKNCWQKFKSCF