Identifiers and Description

Gene Model Identifier

TTHERM_00433640

Standard Name

SNML1 (Sensitive to Nitrogen Mustard 1 nuclease-like protein 1)

Aliases

PreTt26505 | 48.m00268 | 3831.m01604

Description

beta-lactamase superfamily protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04201.1 9.997093137033517e-262
Description: hypothetical protein (525 aa)
Oxytricha Contig13766.0.g88 9.997441244797434e-45
Description: DNA repair metallo-beta-lactamase
DictyBase DDB_G0277755 1.0002124404074584e-26
Description: dclre1 on chromosome: 2 position 8451915 to 8454935
Stentor Coeruleus SteCoe_28813 1.4251640827409352e-21
Description: None
SGD YMR137C 1.000116773704384e-19
Description: PSO2 Nuclease required for a post-incision step in the repair of DNA single and double-strand breaks that result from interstrand crosslinks produced by a variety of mono- and bi-functional psoralen derivatives; induced by UV-irradiation
WormBase WBGene00045237 7.003160085026828e-16
Description: locus:mrt-1 status:Confirmed UniProt:Q8T3E0 protein_id:CAD30439.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00433640(coding)
ATGAGATGCATCACAAACACAAATATAATTGTTGATGATTTTGATTTTTGTAAAAATTTT
AAGAAAAACACTTTTATACATTTTTTGACTCATTTTCATCAGGACCATTATGAAGGCTTA
AGTCCTCTCTGGGATTACTCCCCAATTTATTGCTCTGAAATATCAAAAAACTTAATTTTA
CAAAAATATCCAAAGATATAAAATATTCATGCTCTTCAGCTGAATACAAAGTATGAGTTT
ACCTTAAACAACATAGAGAGTTTAAAAGTTGAAGTTTGGTTCTTCGATGCTCACCATATT
CCTGGGTCTGTTATGATTCTATTTAAAGGTTATATGGGAACTATTTTTCATACTGGAGAT
TTTCGGTTTAATTAATCCATGATTGACTGCAATCCGATTCTGTTTCCTCCTGAATTAAGG
ACCAAAAATCTCCAAAACTGTTCAATTTAAATAGATGAAATGATTTATGACAACACTTAC
TGCAATCCTGCATTCAATTTTCCTAGAGGAGATGAGGTCTTTAAAAGAATGGTTGAAATA
ATAGAAAAGAATAGAAATAAAAGAGTTTTAATAGCAATGGGAGCACTAGGAAAAGAAGAC
ATTTGCATAAAATTATCAGAATATTTTCAAACACTGTTGATAATTGGTGAATCGAAGCTA
CTTTAATTGGAGGCTATAGGGACATACAGGACAGATATTTTTACTACAGATAGAGATTAG
GGTTTTATTGAGATAATAAAAAAAAGACACAGAGAGCAAAAAATATAAGAATTTAAAAGC
CTAAATTATGATTTTATTGTGATTACTACAGACTTTCTAATGTTGGATCATAAAGATCCA
GATGGGATCAATTATATGGTCCCATACAGTCTTCATTCTAACTTTAAAGAAATGGAGTGT
TTAGTAAAGGCAATTTCACCATCAATTTTACGGAGACTAGTTTTAGAAATATATAAATTG
CCTCAGTTTAGAAAAAACCAGGTGATTGACAATATTAAATTCTACTTGAGTTATGTAAAT
GGACTTAAAAGAAAAGGAGAAGGTGGTTACTCATAGTTCAAATAGAAATATACCAGACTG
CATAAGCTAAGTGATGACTTCAGAAGGTGGATGAACCCTGAATCCTAATAAGAGCTCATG
AGCTTCTTAGGTTTGGATGTTGAACCTGATAGAAACCTAAGAAAATATAAAAGAAAAGAA
ATATCAGAAGAGGAATAAGCTAAGCTGGATTTTATATACCAAAACAATCTTCTTAAGCTA
GAAAAAAAGGAATCTCTCTTTGATATTTCAGATAGACTTAAAAGCACGAATAATAACAAA
AGAATAGACCACTTTTTTAGTTCCTAGCAAAACTCATAACAACTCTAAAAGTCTAAAAAA
TTTGATAGCCGCCAATCAGTTAACTCATAAAGTTCTTGTAAAATTGATATTCTAGAAGAC
CCTACTTTGAAGAGTCTTTTTGATTAGTTTTTGAATTCTCAAACGAATTTAAGCTTTATG
AGCCATAAAGGTGATTAAATCAATAATTAAGTTCAGCAAGAGAACCAATAAGAAAAATAA
AATTGA


>TTHERM_00433640(gene)
ATGAGATGCATCACAAACACAAATATAATTGTTGATGATTTTGATTTTTGTAAAAATTTT
AAGAAAAACACTTTTATACATTTTTTGACTCATTTTCATCAGGACCATTATGAAGGCTTA
AGTCCTCTCTGGGATTACTCCCCAATTTATTGCTCTGAAATATCAAAAAACTTAATTTTA
CAAAAATATCCAAAGATATAAAATATTCATGCTCTTCAGCTGAATACAAAGTATGAGTTT
ACCTTAAACAACATAGAGAGTTTAAAAGTTGAAGTTTGGTTCTTCGATGCTCACCATATT
CCTGGGTCTGTTATGATTCTATTTAAAGGTTATATGGGAACTATTTTTCATACTGGAGAT
TTTCGGTTTAATTAATCCATGATTGACTGCAATCCGATTCTGTTTCCTCCTGAATTAAGG
ACCAAAAATCTCCAAAACTGTTCAATTTAAGTAAATTTTTATAGAAATTTAATTAGCATA
TCGAAAATCTTTTGTTTAAACCAGATAGATGAAATGATTTATGACAACACTTACTGCAAT
CCTGCATTCAATTTTCCTAGAGGAGATGAGGTCTTTAAAAGAATGGTTGAAATAATAGAA
AAGAATAGAAATAAAAGAGTTTTAATAGCAATGGGAGCACTAGGAAAAGAAGACATTTGC
ATAAAATTATCAGAATATTTTCAAACACTGTTGATAATTGGTGAATCGAAGGTAAATAGA
TATTTTTTTTATATATTTTTAGCAAATTTGATTTAACTTATTTATGCTCTACTTTTACAA
AAAAAAGCTACTTTAATTGGAGGCTATAGGGACATACAGGACAGATATTTTTACTACAGA
TAGAGATTAGGGTTTTATTGAGATAATAAAAAAAAGACACAGAGAGCAAAAAATATAAGA
ATTTAAAAGCCTAAATTATGATTTTATTGTGATTACTACAGACTTTCTAATGTTGGATCA
TAAAGATCCAGATGGGATCAATTATATGGTCCCATACAGTCTTCATTCTAACTTTAAAGA
AATGGAGTGTTTAGTAAAGGCAATTTCACCATCAATTTTACGGAGACTAGTTTTAGAAAT
ATATAAATTGCCTCAGTTTAGAAAAAACCAGGTGATTGACAATATTAAATTCTACTTGAG
TTATGTAAATGGACTTAAAAGAAAAGGAGAAGGTGGTTACTCATAGTTCAAATAGAAATA
TACCAGACTGCATAAGCTAAGTGATGACTTCAGAAGGTGGATGAACCCTGAATCCTAATA
AGAGCTCATGAGCTTCTTAGGTTTGGATGTTGAACCTGATAGAAACCTAAGAAAATATAA
AAGAAAAGAAATATCAGAAGAGGAATAAGCTAAGCTGGATTTTATATACCAAAACAATCT
TCTTAAGCTAGAAAAAAAGGAATCTCTCTTTGATATTTCAGATAGACTTAAAAGCACGAA
TAATAACAAAAGAATAGACCACTTTTTTAGTTCCTAGCAAAACTCATAACAACTCTAAAA
GTCTAAAAAATTTGATAGCCGCCAATCAGTTAACTCATAAAGTTCTTGTAAAATTGATAT
TCTAGAAGACCCTACTTTGAAGAGTCTTTTTGATTAGTTTTTGAATTCTCAAACGAATTT
AAGCTTTATGAGCCATAAAGGTGATTAAATCAATAATTAAGTTCAGCAAGAGAACCAATA
AGAAAAATAAAATTGA


>TTHERM_00433640(protein)
MRCITNTNIIVDDFDFCKNFKKNTFIHFLTHFHQDHYEGLSPLWDYSPIYCSEISKNLIL
QKYPKIQNIHALQLNTKYEFTLNNIESLKVEVWFFDAHHIPGSVMILFKGYMGTIFHTGD
FRFNQSMIDCNPILFPPELRTKNLQNCSIQIDEMIYDNTYCNPAFNFPRGDEVFKRMVEI
IEKNRNKRVLIAMGALGKEDICIKLSEYFQTLLIIGESKLLQLEAIGTYRTDIFTTDRDQ
GFIEIIKKRHREQKIQEFKSLNYDFIVITTDFLMLDHKDPDGINYMVPYSLHSNFKEMEC
LVKAISPSILRRLVLEIYKLPQFRKNQVIDNIKFYLSYVNGLKRKGEGGYSQFKQKYTRL
HKLSDDFRRWMNPESQQELMSFLGLDVEPDRNLRKYKRKEISEEEQAKLDFIYQNNLLKL
EKKESLFDISDRLKSTNNNKRIDHFFSSQQNSQQLQKSKKFDSRQSVNSQSSCKIDILED
PTLKSLFDQFLNSQTNLSFMSHKGDQINNQVQQENQQEKQN