Identifiers and Description

Gene Model Identifier

TTHERM_00433830

Standard Name

BBC14

Aliases

PreTt26524 | 48.m00287 | 3831.m01623

Description

BBC14 hypothetical protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04219.1 4.997910161537908e-106
Description: hypothetical protein (171 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00433830(coding)
ATGGCTATCAGAAATTTCGTTTTCAAGATTAGCAACTAGATTTAAAACTTAGCTGCCAAG
AGAAGTTTAGCTTACTTGAACTAAATCGATTCTTAGTCTGTTCCTTCTCGTGCCACCATC
AACATGAAGGACTAAGTTACTCAAATGTAGAGAGAAATCGATAATATGGCTAATGTCATT
AGAGCTTAGATCCCTGATGAAGACAGAGCTGAATTTGAAATCCTTAAAAAGTACTACGTT
ACCGGTCAACACGACTCCTTAGTCGATCCCCAAGATGTTCTCCTTCAACTCGACAGAATC
CAAGTCCTCAAGAATCTTAAGATGATCGAATTAAACGAAGAAGCTTATGACCCCGAACTT
GTCAGACTTGAGAAGCTCAAGGCTAGAGTCTTACTTGAAGAAGAAGGTGCCCTTTTGGAA
TATGCTCATTTCATTTCAAAGAGACCTTACAACAAGCCTTATGAAAAATGGGGTGTTAGC
GAAGAACACGTCAAGCAATAAATTCTTGGTTGA


>TTHERM_00433830(gene)
ATGGCTATCAGAAATTTCGTTTTCAAGATTAGCAACTAGATTTAAAAGTAAAACAGACTA
ATAAAGCTAAAATAGCAAATATGGTGACTGGGATAAGAGTATAGGGGCTTTAAATTTTAT
TTAATTGCAAAAGAGCCTTTATTTTACTTCCTTAGTTGCCATATTTTCTTACTAAAATTA
CTTTTATTTAATCATATTAAACTATTAAATACAATTATAAATAGCTTAGCTGCCAAGAGA
AGTTTAGCTTACTTGAACTAAATCGATTCTTAGTCTGTTCCTTCTCGTGCCACCATCAAC
ATGAAGGACTAAGTTACTCAGTAATTCATTTTACATCTAAATAGGATTTAAATTTATTCT
TTCCTCAATTGATTTATTCACTTATGTATGAGCACAAAGATCTAAGTTAGTTTGTTAGTT
AGTTAGCTATTGTATTATTTATTTATTTAGTATTGATTGATCAATCTATCTATCTATCTT
TCGATCGTAAAGGAAAATTGCATTTATTTTTATATGAAATTTGCAAGCATATCAAAAAAA
ATAGAATGGGCTTCATTCAAATAGTGCTTAGTAGTGATAAATATCTTCTGAAAATGCTAT
AAATAAAAAATAAGCAATAATATTAAGCAAAACAATACCAAAGATACAACCATAAATGCG
CATGTTTTAAAACCAAAAGCTTTAATTGCTCTTAATTTTAATCAATTGAAAAAAGTTATT
TACTCATTCAACCTTACTAACTCTATTTTATTCCAAAATTAGAATGTAGAGAGAAATCGA
TAATATGGCTAATGTCATTAGAGCTTAGATCCCTGATGAAGACAGAGCTGAATTTGAAAT
CCTTAAAAAGTACTACGTTACCGGTCAACACGACTCCTTAGTCGATCCCCAAGATGTTCT
CCTTCAACTCGACAGAATCCAAGTCCTCAAGAATCTTAAGTAAGAAATAGTTTAAACAAA
TACTAAAAAAAAGTGAATGAATAAATAAACAAAGAGAGAGAGAAATTAACAAATAAATAA
ACCATACATTTACAAAAATAACTATTGTTAAAATAAATGCCTACACAAAATATATTAACA
AAAAGTGATCTTAGATACTTGAATTAAGTATTTTTTTTCTTAAAAGAATCTTAAAATTAA
TTATTTTATTTGAGAATTAAAACTGATATTTTAAAACATTTTAAATTTTAATTTAATTAA
TGAAATAAATTTAAAAAATAAAATAAATTCCTAAAGTAATTATTAGTATCCTTGATTAAT
TAAATTGGTTAAATATGTTTACAAAAGATTTCATTATTAAAATATATTTATTTATTTATA
AAGAGAAGAAAATAAAATAATGAATTAATAATTAAATCTTCATCTTGCTAATCATTATCA
TTACTTAAATGCTTACAACCTTATTTTTAAAATAGGATGATCGAATTAAACGAAGAAGCT
TATGACCCCGAACTTGTCAGACTTGAGAAGCTCAAGGCTAGAGTCTTACTTGAAGAAGAA
GGGTAATTAATTTAATTTTGATTGATTAATTTAATGTTTGTTTTTTTACTTAAATAATTT
AAAAATTAATGTTAATTTTTATAATTTAATATAAAATAAGATGATACTGTTTTATTTAAA
ATAACATCATCACTCATCAATTACAAAAATTACTTAGTTTTTTATTTGTTTGTTTAAATC
AACTTAAAAGACTGATTTCTATATCTATTTGTTTAACTTCATATTTTTGATTTTAATTTT
ATTAAAAATAAACAGTGCCCTTTTGGAATATGCTCATTTCATTTCAAAGAGACCTTACAA
CAAGCCTTATGAAAAATGGGGTGTTAGCGAAGAACACGTCAAGCAATAAATTCTTGGTTG
A


>TTHERM_00433830(protein)
MAIRNFVFKISNQIQNLAAKRSLAYLNQIDSQSVPSRATINMKDQVTQMQREIDNMANVI
RAQIPDEDRAEFEILKKYYVTGQHDSLVDPQDVLLQLDRIQVLKNLKMIELNEEAYDPEL
VRLEKLKARVLLEEEGALLEYAHFISKRPYNKPYEKWGVSEEHVKQQILG