Identifiers and Description

Gene Model Identifier

TTHERM_00437617

Standard Name

RAD27 (5' to 3' exonuclease)

Aliases

3708.m00952

Description

flap endonuclease-1; flap endonuclease-1 PIN domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00560 ) Leucine Rich Repeat
  • ( PF00752 ) XPG N-terminal domain
  • ( PF00867 ) XPG I-region
  • ( PF01367 ) 5'-3' exonuclease, C-terminal SAM fold
  • ( PF07708 ) Tash protein PEST motif

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12460.1 9.997093137033517e-262
Description: flap endonuclease-1 (387 aa)
Oxytricha Contig12777.0.g42 9.996261361959507e-120
Description: XPG I-region
WormBase WBGene00000794 5.998625834015334e-112
Description: locus:crn-1 Flap endonuclease 1 status:Confirmed UniProt:Q9N3T2 protein_id:CCD72553.1
SGD YKL113C 2.000234809436283e-103
Description: RAD27 5 to 3 exonuclease, 5 flap endonuclease, required for Okazaki fragment processing and maturation as well as for long-patch base-excision repair; member of the S. pombe RAD2/FEN1 family
DictyBase DDB_G0284987 1.9998944264638884e-101
Description: repG on chromosome: 4 position 2762877 to 2764154
Stentor Coeruleus SteCoe_27474 1.5400882849875202e-51
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00437617(coding)
ATGGGAATTCATAAATTGATGGATCTATTAAAGGAGAAAGCTCCTGGATGCATTAAGACA
TCAGATCTAAAATTCTATGCTGGCCGTATGATTGCATGTGATGCCTCTATGGCAATGTAT
TAATTTTTAGCAACTACAAGCAGTGCTTCTGATTTCTAGATATAAAATTTAACAGATAAA
GATGGCAATAAAACAGGACATTTAGTTGGTTTACTTAATAGAACTGTAATGCTTATCGAA
AATGGTCTCAAGCCAGTTTGGGTTTTCGATGGTAAACCTCCTTAATTCAAGAGTGGTGAA
CTTGCAAGAAGACAAAAAGCAAAAGACGAAGCTGCTGAAAAGTAAAAAACTGCTATAGAA
ACTGGTGATATGTAAGAAGCTTTAAAGCAAGAACAACGTAATTTGCATATTACAAAAGAA
ATGAAAGCTGATGCAATAAAATTACTTTAATTGGTTGGTGTTCCAGTGATTTTAGCCCCA
TGTGAAGCAGAAGCATAATGCGCTGCTTTGGCAAAAGCTAAGAAAGTTTTTGCTACTGTT
ACTGAAGATATGGATGCTCTCACTTTTGCTACACCTTTTCTCTTGAGAAATCTCAATAGT
AAAAAGGAACCAATTACAGAAATAAACTACGAAAAGATGCTATAAGAATTAAAGTTATCT
CATAATGAATTTGTTGATTTGTGTATCTTATGTGGATGCGATTATTTAGGACGTATAGAA
GGTGTTGGCCCAGTTAATGCTTTCAAACTTATAACAGAGCACAAATCTCTAGAGAAAGTT
CTTGAACACATGGAAGAAGTTAACAAACAAAGCACTAAAAAATAAAAATATACAGTACCA
AGTTCTTATGATTATGTATCAGCAAGAGATCTTTTTATTAATCCTGAAGTTACTGATCCA
GAGACTATTTAGCTTGAATGGAAGAAACCAGATGTAGAAGAATTAAAGAAATTTTTAGTA
GAAGAAAAAGGATTTAGCGAGTAAAGAGTTACCAGTTAGATGGAAAAAGTTTTAAATGCT
AAAGAACATAAAGGTTCTTAAACCAGACTGAATGATTTCTTTAAAGTATAGCCTAAAGAT
ACATCATCAACAAGTAAGGCATCTAAAAAGCCAACAAATACTAAAAGTGCAAATAAAAAG
GGAGGAAAAAAATGA


>TTHERM_00437617(gene)
ATGGGAATTCATAAATTGATGGATCTATTAAAGGAGAAAGCTCCTGGATGCATTAAGACA
TCAGATCTAAAATTCTATGCTGGCCGTATGATTGCATGTGATGCCTCTATGGTAATCAAT
AACTAATTTAAGCATAATCTAATTATTTTATTCATATTTACTATAAATAGGCAATGTATT
AATTTTTAGCAACTACAAGCAGTGCTTCTGATTTCTAGATATAAAATTTAACAGATAAAG
ATGGCAATAAAACAGGACATTTAGTTGGTTTACTTAATAGAACTGTAATGCTTATCGAAA
ATGGTCTCAAGCCAGTTTGGGTTTTCGATGGTAAACCTCCTTAATTCAAGAGTGGTGAAG
TAATAAATAAATAAACAAATTCATTCAACATTTTTTAAAGATTGAACTTAATGAAATATT
TAAAAATATTTTTTATTTATAAGCTTGCAAGAAGACAAAAAGCAAAAGACGAAGCTGCTG
AAAAGTAAAAAACTGCTATAGAAACTGGTGATATGTAAGAAGCTTTAAAGCAAGAACAAC
GTAATTTGCATATTACAAAAGAAATGAAAGCTGATGCAATAAAATTACTTTAATTGGTTG
GTGTTCCAGTGATTTTAGCCCCATGTGAAGCAGAAGCATAATGCGCTGCTTTGGCAAAAG
CTAAGAAAGTTTTTGCTACTGTTACTGAAGATATGGATGCTCTCACTTTTGCTACACCTT
TTCTCTTGAGAAATCTCAATAGTAAAAAGGAACCAATTACAGAAATAAACTACGAAAAGA
TGCTATAAGAATTAAAGTTATCTCATAATGAATTTGTTGATTTGTGTATCTTATGTGGAT
GCGATTATTTAGGACGTATAGAAGGTGTTGGCCCAGTTAATGCTTTCAAACTTATAACAG
AGCACAAATCTCTAGAGAAAGTTCTTGAACACATGGAAGAAGTTAACAAACAAAGCACTA
AAAAATAAAAATATACAGTACCAAGTTCTTATGATTATGTATCAGCAAGAGATCTTTTTA
TTAATCCTGAAGTTACTGATCCAGAGACTATTTAGGTAAAATTGATCTTTTTTATGTAAA
TATTTATATATAAACTGTGTTTATTTATAAAAAGCTTGAATGGAAGAAACCAGATGTAGA
AGAATTAAAGAAATTTTTAGTAGAAGAAAAAGGATTTAGCGAGTAAAGAGTTACCAGTTA
GATGGAAAAAGTTTTAGTAAAATTATATTTTTTAAATTAAATAAAAATTTATTTTAAATT
AATCATAGAATGCTAAAGAACATAAAGGTTCTTAAACCAGACTGAATGATTTCTTTAAAG
TATAGCCTAAAGATACATCATCAACAAGTAAGGCATCTAAAAAGCCAACAAATACTAAAA
GTGCAAATAAAAAGGGAGGAAAAAAATGA


>TTHERM_00437617(protein)
MGIHKLMDLLKEKAPGCIKTSDLKFYAGRMIACDASMAMYQFLATTSSASDFQIQNLTDK
DGNKTGHLVGLLNRTVMLIENGLKPVWVFDGKPPQFKSGELARRQKAKDEAAEKQKTAIE
TGDMQEALKQEQRNLHITKEMKADAIKLLQLVGVPVILAPCEAEAQCAALAKAKKVFATV
TEDMDALTFATPFLLRNLNSKKEPITEINYEKMLQELKLSHNEFVDLCILCGCDYLGRIE
GVGPVNAFKLITEHKSLEKVLEHMEEVNKQSTKKQKYTVPSSYDYVSARDLFINPEVTDP
ETIQLEWKKPDVEELKKFLVEEKGFSEQRVTSQMEKVLNAKEHKGSQTRLNDFFKVQPKD
TSSTSKASKKPTNTKSANKKGGKK