Identifiers and Description

Gene Model Identifier

TTHERM_00439000

Standard Name

HEM15 (HEMe biosynthesis)

Aliases

PreTt05457 | 49.m00229 | 3708.m00078

Description

ferrochelatase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12426.1 9.997093137033517e-262
Description: ferrochelatase (370 aa)
DictyBase DDB_G0288891 6.998759398018207e-85
Description: hemH on chromosome: 5 position 2088484 to 2089755
SGD YOR176W 9.996373193201036e-79
Description: HEM15 Ferrochelatase, a mitochondrial inner membrane protein, catalyzes the insertion of ferrous iron into protoporphyrin IX, the eighth and final step in the heme biosynthetic pathway
Stentor Coeruleus SteCoe_29361 4.0795586671775603e-41
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00439000(coding)
ATGCTTAGTTAGATATTCAGTAGAACTTTTTCATCTAGCAAATAACAAGCTAAAACAGCT
GTTTTTATGCTTAATTTAGGTGGACCTAATAGCTTAGAAGAAGTATCTCCATTTTTAGAG
AGATTCTTCGCAGACTCTACAGTCATCAGAATACCTTTTGGTTTAGGACCTAAGATTGGT
AAGCTACGTGGTCCTGCCAAAGTTACCAAGTAGTATGAAGCTATTGGAGGAAGAAGCCCT
ATTCAAGATTGGACAAGAAAATAAGGTGAAAAAATGGTTGAAAAATTAGATTAAATTTCA
CCAGACACAGCTCCTCATATTTATTTTCCAGCATTCAGATATGGACTTCCTCTTTACACT
GAATCTATTAAAGAATGTATTGAAAAGAATCCAACTGTAGAAAAATTTGTATTTTTTTCA
TAGTATCCTTAATATTCTTGCACTACAGCTGGAAATAACATTAGAGAAGCATTAAAACAT
TTAAAGGAGCAGTATAAAAACCATGGAAAAACCATCCATGTGATTGATAGATGGTATAAT
CATCCTGGTTATGTTAAAACAATTTCTAGATTGCTCTCAGAAGACCTTAAAAATAACTTT
AAAGAGGAAGATAGAGATAATGTATTAATATTATTTTCTGCTCACAGTCTCCCATTTGAT
TTTGTTAAGCAAGGTGATACATATCCATATGAAATAGGAACTACTGCAAATTTAGTAATT
TAAGAAGCTAAATTGAAGAACCCACACAGAGTTGTTTGGCAAAGTAAAGTTGGTTTCTAA
CAATGGTTAGCACCAAACACTATGCATGCATTAGAATAGGCTTCTAATTAAGGTTGGAAA
AATGTTATCTTAGTTCCTCTAGGTTTCACTAGTGATCACTTAGAAACACTCTATGAATTA
GATTTAGAATATATCAAGGAAAGTTAGGAAAAATTAAAGTTTAATAAAATAATAAGAGCA
AGAAGTTTAAATGATGATCAATAATTTTGTGATTCCTTAGCAGATATTGTTTCTTAGAAT
TTAAAAACTGATGCTTATAAATCTCCAAATTTAAAACTAAGATGCCCTGATTGCAAAATA
CCTGAATGCAACTTACTAAGTGCAGTTTGA


>TTHERM_00439000(gene)
ATGCTTAGTTAGATATTCAGTAGAACTTTTTCATCTAGCAAATAACAAGCTAAAACAGCT
GTTTTTATGCTTAATTTAGGTGGACCTAATAGCTTAGAAGAAGTATCTCCATTTTTAGAG
AGATTCTTCGCAGACTCTACAGTCATCAGAATACCTTTTGGTTTAGGTTAGAAATTAGAT
TTGATTTTTAATTAGATTTATGCAAAAAAAAAATGAGAGAGAGATCAAAATTTAGAAAAT
AAAGGGATTATTTAATAATTATTTGAACTTATTAATAATAAATAGGACCTAAGATTGGTA
AGCTACGTGGTCCTGCCAAAGTTACCAAGTAGTATGAAGCTATTGGAGGAAGAAGCCCTA
TTCAAGATTGGACAAGAAAATAAGGTGAAAAAATGGTTGAAAAATTAGATTAAATTTCAC
CAGACACAGCTCCTCATATTTATTTTCCAGCATTCAGATATGGACTTCCTCTTTACACTG
AATCTATTAAAGAATGTATTGAAAAGAATCCAACTGTAGAAAAATTTGTATTTTTTTCAT
AGTATCCTTAATATTCTTGCACTACAGCTGGAAATAACATTAGAGAAGCATTAAAACATT
TAAAGGAGCAGTATAAAAACCATGGAAAAACCATCCATGTGATTGATAGATGGTATAATC
ATCCTGGTTATGTTAAAACAATTTCTAGATTGCTCTCAGAAGACCTTAAAAATAACTTTA
AAGAGGTTTGTTCAAAAATTAATTTTATTGTTGAAAAATAAAAATATCTTTTTTAATAAA
ATAAATCTGAATAGGAAGATAGAGATAATGTATTAATATTATTTTCTGCTCACAGTCTCC
CATTTGATTTTGTTAAGCAAGGTGATACATATCCATATGAAATAGGAACTACTGCAAATT
TAGTAATTTAAGAAGCTAAATTGAAGAACCCACACAGAGTTGTTTGGCAAAGTAAAGTTG
GTTTCTAACAATGGTTAGCACCAAACACTATGCATGCATTAGAATAGGCTTCTAATTAAG
GTTGGAAAAATGTTATCTTAGTTCCTCTAGGTTTCACTAGTGATCACTTAGAAACACTCT
ATGAATTAGATTTAGAATATATCAAGGAAAGTTAGGAAAAATTAAAGTTTAATAAAATAA
TAAGAGCAAGAAGTTTAAATGATGATCAATAATTTTGTGATTCCTTAGCAGATATTGTTT
CTTAGAATTTAAAAACTGATGCTTATAAATCTCCAAATTTAAAACTAAGATGCCCTGATT
GCAAAATACCTGAATGCAACTTACTAAGTGCAGTTTGA


>TTHERM_00439000(protein)
MLSQIFSRTFSSSKQQAKTAVFMLNLGGPNSLEEVSPFLERFFADSTVIRIPFGLGPKIG
KLRGPAKVTKQYEAIGGRSPIQDWTRKQGEKMVEKLDQISPDTAPHIYFPAFRYGLPLYT
ESIKECIEKNPTVEKFVFFSQYPQYSCTTAGNNIREALKHLKEQYKNHGKTIHVIDRWYN
HPGYVKTISRLLSEDLKNNFKEEDRDNVLILFSAHSLPFDFVKQGDTYPYEIGTTANLVI
QEAKLKNPHRVVWQSKVGFQQWLAPNTMHALEQASNQGWKNVILVPLGFTSDHLETLYEL
DLEYIKESQEKLKFNKIIRARSLNDDQQFCDSLADIVSQNLKTDAYKSPNLKLRCPDCKI
PECNLLSAV