Identifiers and Description

Gene Model Identifier

TTHERM_00441940

Standard Name

FZY9 (FiZzY 9)

Aliases

PreTt05594 | 50.m00163 | 3681.m00022

Description

FZY9 anaphase-promoting complex protein; Fizzy/CDC20/CDH1 family protein; homolog of S. cerevisiae CDH1- a cell cycle regulated activator of the anaphase-promoting complex/cyclosome (APC/C)- which directs ubiquitination of various targets

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12532.1 9.997093137033517e-262
Description: hypothetical protein (578 aa)
WormBase WBGene00001510 9.004095103885247e-102
Description: locus:fzr-1 status:Partially_confirmed UniProt:Q09649 protein_id:CAA87433.1
Oxytricha Contig4092.0.g70 1.0000943968537097e-101
Description: WD domain, G-beta repeat
SGD YGL003C 4.000477177765533e-93
Description: CDH1 Cell-cycle regulated activator of the anaphase-promoting complex/cyclosome (APC/C), which directs ubiquitination of cyclins resulting in mitotic exit; targets the APC/C to specific substrates including Cdc20p, Ase1p, Cin8p and Fin1p
DictyBase DDB_G0287259 1.0002434920975502e-91
Description: cdh1 on chromosome: 5 position 54882 to 57146
Stentor Coeruleus SteCoe_28333 6.813556821545298e-46
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00441940(coding)
ATGAACTTTACTTCCCCACTCAAGTCAAATAAAGCCAATAATCTGTTTGAAAGCCCTTCT
TGCTATATGTCTCCATCCGCTTTTGATAAAAAGGGCGATTAAAATACAAATACTTTAAAT
GTAATTAATGCACCATTCTGCAACTCAATTCAGTAAAATAAGAGTCCTCAAAATTCTTAG
TTCAAAACCCCTACAAAGTACTCTGATCGCTTTATTCCCGCAAGAACAGATTCTATTAGT
AAAACTCTGTTCGATTTAAAAGATGAAATGATTGTAGAAGAATAACCTGCAAATAGAATG
CTTACAGAGTCTCCTTTTCTTTTTTAAGGATCAAGATAATCTCATGCAAATAATTCAAAT
AGTTAGAGCACAACCATCAATGGATTTTCTAATGGACATACTCTAAATTCTTCTCAATAA
TTGACAACCCCAAGTAAAAAAGTCAACTTCTTAAGTTAGTAAGATGAAAACACTAAATCT
TATAATGAGTTAATTCAAAGAGAACTTTTTGGTAATTACGAAGGATCTAATAATAAAAAG
TCCTCAGAGGAACTTTAAAAAACACCCATTCTCAAATTTCACTGGGACTAAAAAAATGCA
ACTACATCTCCTCTTCTCAACATTTAGCAATCACCATTCTAGATTTCTACCCCAGATGAT
CGTTCAAAAGAGTAAAAACGTAAAATATCTAAAACACCTTTCAAAGTATTAGATGCTCCT
TAACTCTAAGACGATTTTTATGTTGATTTACTAGACTGGAGTTCACAAAATTTGATAGCA
GTAGGATTAGGAAAATCTATCTTTATTTGGAATGCTGCCACTGGAAGTGTATAAAAACTC
TGTGATAGTAAAGCTTCCAACTTTGGAACTAATATCGAAAATTGCTAAAACTAATCTCAA
CTATCTTAATACACAAGCTTAAAATGGTCACCTAACGGTAACTAAATTGCACTCGGAAAT
TACAACGGATAAGTTGAACTTTGGGACTTAACTACCAGACAGCTTATTTCTGAGTTCTCT
GCATAAAAAGAAAGAATAGGATGTATTGATTTCAACAACAATAATGTTTTTGCAGCTGGC
TCTAAAGATAAAAGCATCCTTATTCAAGATATTCGTGACCCAAAAATTTTAAGAATGGCT
AGAGGTCATAAATAAGAAATATGTTAAGTCAAGTGGTCTCCAGATCAACAATATCTTGCT
TCAGGAGGTAATGATAACATGGTAGCTATATGGGATATAGCTCGTTCCTATAGCTAAAAC
ATAAATGGCTTTGGTTCGAATGAAATTAGTCCCTACCAAAAACATAATGAACATTAGGCA
GCCGTAAGAGCTCTAGCATGGAATCCTCATTAGTATGGAGTATTATTAAGTGGAGGTGGA
TCAAGAGATTAAACTATAAAAGTATGGAATATAAATACTAATAGTTTACTTGGATCTGTT
GAGGTTGGTTCTTAAGTTTGTAAATTACTATTTTCTCCAGATTAGAATGAATTTGTTTGT
GCTCATGGATTTGAATATAACAAAGTAACAGTCTGGAAATATCCTACTATGAGCTAAATC
GCAGAACTTGAAGGACATTAAAGCAGAGTTCTATTTATGAGCATGGCACCTGATAATCAG
ACTATTGTTACTGGTGCTGGTGATGAAACTCTTAAATTCTGGAAGATCTTTTAAGGTAGA
CCTGTTTCTAAATAACAATCATTGCTTAAGCATTCTGATTTAAGGTGA


>TTHERM_00441940(gene)
ATGAACTTTACTTCCCCACTCAAGTCAAATAAAGCCAATAATCTGTTTGAAAGCCCTTCT
TGCTATATGTCTCCATCCGCTTTTGATAAAAAGGGCGATTAAAATACAAATACTTTAAAT
GTAATTAATGCACCATTCTGCAACTCAATTCAGTAAAATAAGAGTCCTCAAAATTCTTAG
TTCAAAACCCCTACAAAGTACTCTGATCGCTTTATTCCCGCAAGAACAGATTCTATTAGT
AAAACTCTGTTCGATTTAAAAGATGAAATGATTGTAGAAGAATAACCTGCAAATAGAATG
CTTACAGAGTCTCCTTTTCTTTTTTAAGGATCAAGATAATCTCATGCAAATAATTCAAAT
AGTTAGAGCACAACCATCAATGGATTTTCTAATGGACATACTCTAAATTCTTCTCAATAA
TTGACAACCCCAAGTAAAAAAGTCAACTTCTTAAGTTAGTAAGATGAAAACACTAAATCT
TATAATGAGTTAATTCAAAGAGAACTTTTTGGTAATTACGAAGGATCTAATAATAAAAAG
TCCTCAGAGGAACTTTAAAAAACACCCATTCTCAAATTTCACTGGGACTAAAAAAATGCA
ACTACATCTCCTCTTCTCAACATTTAGCAATCACCATTCTAGATTTCTACCCCAGATGAT
CGTTCAAAAGAGTAAAAACGTAAAATATCTAAAACACCTTTCAAAGTATTAGATGCTCCT
TAACTCTAAGACGATTTTTATGTTGATTTACTAGACTGGAGTTCACAAAATTTGATAGCA
GTAGGATTAGGAAAATCTATCTTTATTTGGAATGCTGCCACTGGAAGTGTATAAAAACTC
TGTGATAGTAAAGCTTCCAACTTTGGAACTAATATCGAAAATTGCTAAAACTAATCTCAA
CTATCTTAATACACAAGCTTAAAATGGTCACCTAACGGTAACTAAATTGCACTCGGAAAT
TACAACGGATAAGTTGAACTTTGGGACTTAACTACCAGACAGCTTATTTCTGAGTTCTCT
GCATAAAAAGAAAGAATAGGATGTATTGATTTCAACAACAATAATGTTTTTGCAGCTGGC
TCTAAAGATAAAAGCATCCTTATTCAAGATATTCGTGACCCAAAAATTTTAAGAATGGCT
AGAGGTCATAAATAAGAAATATGTTAAGTCAAGTGGTCTCCAGATCAACAATATCTTGCT
TCAGGAGGTAATGATAACATGGTAGCTATATGGGATATAGCTCGTTCCTATAGCTAAAAC
ATAAATGGCTTTGGTTCGAATGAAATTAGTCCCTACCAAAAACATAATGAACATTAGGCA
GCCGTAAGAGCTCTAGCATGGAATCCTCATTAGTATGGAGTATTATTAAGTGGAGGTGGA
TCAAGAGATTAAACTATAAAAGTATGGAATATAAATACTAATAGTTTACTTGGATCTGTT
GAGGTTGGTTCTTAAGTTTGTAAATTACTATTTTCTCCAGATTAGAATGAATTTGTTTGT
GCTCATGGATTTGAATATAACAAAGTAACAGTCTGGAAATATCCTACTATGAGCTAAATC
GCAGAACTTGAAGGACATTAAAGCAGAGTTCTATTTATGAGCATGGCACCTGATAATCAG
ACTATTGTTACTGGTGCTGGTGATGAAACTCTTAAATTCTGGAAGATCTTTTAAGGTAGA
CCTGTTTCTAAATAACAATCATTGCTTAAGCATTCTGATTTAAGGTGA


>TTHERM_00441940(protein)
MNFTSPLKSNKANNLFESPSCYMSPSAFDKKGDQNTNTLNVINAPFCNSIQQNKSPQNSQ
FKTPTKYSDRFIPARTDSISKTLFDLKDEMIVEEQPANRMLTESPFLFQGSRQSHANNSN
SQSTTINGFSNGHTLNSSQQLTTPSKKVNFLSQQDENTKSYNELIQRELFGNYEGSNNKK
SSEELQKTPILKFHWDQKNATTSPLLNIQQSPFQISTPDDRSKEQKRKISKTPFKVLDAP
QLQDDFYVDLLDWSSQNLIAVGLGKSIFIWNAATGSVQKLCDSKASNFGTNIENCQNQSQ
LSQYTSLKWSPNGNQIALGNYNGQVELWDLTTRQLISEFSAQKERIGCIDFNNNNVFAAG
SKDKSILIQDIRDPKILRMARGHKQEICQVKWSPDQQYLASGGNDNMVAIWDIARSYSQN
INGFGSNEISPYQKHNEHQAAVRALAWNPHQYGVLLSGGGSRDQTIKVWNINTNSLLGSV
EVGSQVCKLLFSPDQNEFVCAHGFEYNKVTVWKYPTMSQIAELEGHQSRVLFMSMAPDNQ
TIVTGAGDETLKFWKIFQGRPVSKQQSLLKHSDLR