Identifiers and Description

Gene Model Identifier

TTHERM_00442100

Standard Name

ARP3 (Actin-Related Protein 3)

Aliases

PreTt05610 | 50.m00179 | 3681.m00038

Description

ARP3 actin

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12547.1 9.997093137033517e-262
Description: actin family protein (425 aa)
Oxytricha Contig14042.0.g94 1.000274544751666e-156
Description: Actin
WormBase WBGene00000199 3.99907102031635e-130
Description: locus:arx-1 Actin-related protein 3 status:Confirmed UniProt:Q9N4I0 protein_id:CCD73510.1
DictyBase DDB_G0283755 4.000347951747671e-122
Description: arpC on chromosome: 4 position 1135639 to 1137330
SGD YJR065C 1.99959632430224e-111
Description: ARP3 Essential component of the Arp2/3 complex, which is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity
Stentor Coeruleus SteCoe_30887 1.733141042341547e-58
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16732560: Kuribara S, Kato M, Kato-Minoura T, Numata O (2006) Identification of a novel actin-related protein in Tetrahymena cilia. Cell motility and the cytoskeleton 63(7):437-46

Sequences

>TTHERM_00442100(coding)
ATGGATAATAAATGCTTCATAGAAAATAAAGTAGCTATTATTGATAATGGTACAGGCTAC
ACAAAAATGGGTTGGGGTGGAAACATTGAACCAACTTATGATATTCCCACAGTCATTTCA
GATAATAGCGATAAAAATTCAGTTTAAGTTAGTAAGAATTACAATGAATAATTAGATTTT
TGCATCGGTAATGATGCCTTGAATTAGTAAGTCAAAACTTATCCTATGAAGTCTGGTATT
GTAACAGACTGGACTTTAATGGAAAAGTTCTGGTAAAAAAGCATATTTGATTATCTTCGT
TGTGATCCCGACGAAACCACATTTGTTCTTACTGAACCTCCTATGAATCCTCCTGAAAAT
AGAGAAAACATAGCAGAAATTTTCTTTGAAACATTTAATGCAAAAAGCATTTATATTGGA
GTTCAAGCCGTGCTCGCTCTCTACTCAAATTAAATGCACGAATAAAATGCCCAAACAGGA
AACAAATTGACTGGTTGCGTCTTAGATTCTGGTGATGGTGTTACTCACATTATTCCAGTC
AGTGATGGATATGTTATCGGTAGTTGTATTAAGCATATTCCTCTTGCTGGTAGAGACATT
ACAAATTTCATAGCTTAAATGATTAGAGATAGAGGTGAAAAAGTTAATAACTAAGACATT
AACAGAATCTCTGCAGAAATTAAAGAAAAGTATGGTTACGTAGCACCTAAAGGTTTATTA
TAAGAATTTGAAAGATATGACAAGCCTGGCAAAGATGGTAAGCCTTCCAATAAATTTAAG
CAATACACTTTCGAAAGTTAAGTTGATAAAAAATAATATACCATGGATGTTGGCTATGAA
CGTTTCTTAGGTCCTGAAATGTTCTTCTACCCTGAATTCTTTGACTCTAAATGGAGAACT
TCTATTGATGAATCTATTGATAATGCAATTTAAGGATCCCCAATTGATACTAGAAGACAT
CTTTATTCAAATATTGTGTTATCTGGTGGTTCTACTATGTTTGAGGGTTTCACTGATAGA
TTATAGTCAGCCATTTAAAAAAGAGTAGATGATAGACTTTTGAGATATTCTACTGCTTTA
AGTAAACCTTAACCAATTGTAGTTTAAGTCGCACAAAATCCTCACTAACGTTTTTCAGTC
TGGTAAGGAGGTAGTTTGCTCTCAATAAAACCCGGCTTTGAAAAAGTATGTAAGAGTAGA
TAAGAATACTTAGAATATGGTCCTTCAATAGTAAGACAAAACGCTGTTTTATCTTCTGGA
ATGTGA


>TTHERM_00442100(gene)
ATGGATAATAAATGCTTCATAGAAAATAAAGTAGCTATTATTGATAATGGTACAGGGTAA
TGATTATATATTCATTTATTAAGCAAAATAAGCTATCAGAAATTATGCAAGCATACATTT
ATTTTATCTAATATGAATAATCGATTGTCATTAATAATGTATAACATTTTATCAAAAAAG
CTACACAAAAATGGGTTGGGGTGGAAACATTGAACCAACTTATGATATTCCCACAGTCAT
TTCAGATAATAGCGATAAAGTATTTAAGAATTATATGACCTAAAAGATTTACATTTACTT
TAATTTAAAAATAGAATTCAGTTTAAGTTAGTAAGAATTACAATGAATAATTAGATTTTT
GCATCGGTAATGATGCCTTGAATTAGTAAGTCAAAACTTATCCTATGAAGTCTGGTATTG
TAACAGACTGGACTTTAATGGAAAAGTTCTGGTAAAAAAGCATATTTGATTATCTTCGTT
GTGATCCCGACGAAACCACATTTGTTCTTACTGAACCTCCTATGAATCCTCCTGAAAATA
GAGAAAACATAGCAGAAATTTTCTTTGAAACATTTAATGCAAAAAGCATTTATATTGGAG
TTCAAGCCGTGCTCGCTCTCTACTCAAATTAAATGCACGAATAAAATGCCCAAACAGGAA
ACAAATTGACTGGTTGCGTCTTAGATTCTGGTGATGGTGTTACTCACATTATTCCAGTCG
TAAGAATTTTTTTTTTAATACCCAATACATACATAAATATCTTTGATGTGATTTTTTATT
CATTCATTCCAAATAGCTAATAATTAAATTTCTGTCAAACATAAATACAAATCAAATCAA
ATTATTGGTTTCTTTCATTCGCACTTACCTAATAAATTTTTATATTTTAAGGCAAATTAT
ATTAAGATATTTTCAGATTTTTAGAGCTTATATTAAAATCCTATTTATATTTTTAATGAA
TAATTCATTGTATTTTTTTTATATTTAATAAGAGTGATGGATATGTTATCGGTAGTTGTA
TTAAGCATATTCCTCTTGCTGGTAGAGACATTACAAATTTCATAGCTTAAATGATTAGAG
ATAGAGGTGAAAAAGTTAATAACTAAGACATTAACAGAATCTCTGCAGAAATTAAAGAAA
AGTATGGTTACGTAGCACCTAAAGGTTTATTATAAGAATTTGAAAGATATGACAAGCCTG
GCAAAGATGGTAAGCCTTCCAATAAATTTAAGCAATACACTTTCGAAAGTTAAGTTGATA
AAAAAGTAATTAATATTATTTCTAAAGAAAGAATTTAATTTTTATATTGATCTTAATTAA
AGTAATATACCATGGATGTTGGCTATGAACGTTTCTTAGGTCCTGAAATGTTCTTCTACC
CTGTAATTAAATTAATTCTACTCACTAAATATATTAATATTAATGAATTTACTAAAGGAA
TTCTTTGACTCTAAATGGAGAACTTCTATTGATGAATCTATTGATAATGCAATTTAAGGA
TCCCCAATTGATACTAGAAGACATCTTTATTCAGTAAACATTAAAAAATATGATAAATTT
CTTATTCTTTCATAAAAATTATAGAATATTGTGTTATCTGGTGGTTCTACTATGTTTGAG
GGTTTCACTGATAGATTATAGTCAGCCATTTAAGTAATCAGACTTAATTAATTTTTTTAT
GAAATCATACATTTTAATATTAATAATTTAATCTAGAAAAGAGTAGATGATAGACTTTTG
AGATATTCTACTGCTTTAAGTAAACCTTAACCAATTGTAGTTTAAGTCGCACAAAATCCT
CACTAACGTTTTTCAGTCTGGTAAGGAGGTAGTTTGCTCTCAATAAAAGTAAAATCTTAA
TAAAAATCTATAAATCTAATATATTTATCTAAACTTTTAAATGTTAGCCCGGCTTTGAAA
AAGTATGTAAGAGTAGATAAGAATACTTAGAATATGGTCCTTCAATAGTAAGACAAAACG
CTGTTTTATCTTCTGGAATGTGA


>TTHERM_00442100(protein)
MDNKCFIENKVAIIDNGTGYTKMGWGGNIEPTYDIPTVISDNSDKNSVQVSKNYNEQLDF
CIGNDALNQQVKTYPMKSGIVTDWTLMEKFWQKSIFDYLRCDPDETTFVLTEPPMNPPEN
RENIAEIFFETFNAKSIYIGVQAVLALYSNQMHEQNAQTGNKLTGCVLDSGDGVTHIIPV
SDGYVIGSCIKHIPLAGRDITNFIAQMIRDRGEKVNNQDINRISAEIKEKYGYVAPKGLL
QEFERYDKPGKDGKPSNKFKQYTFESQVDKKQYTMDVGYERFLGPEMFFYPEFFDSKWRT
SIDESIDNAIQGSPIDTRRHLYSNIVLSGGSTMFEGFTDRLQSAIQKRVDDRLLRYSTAL
SKPQPIVVQVAQNPHQRFSVWQGGSLLSIKPGFEKVCKSRQEYLEYGPSIVRQNAVLSSG
M