Identifiers and Description

Gene Model Identifier

TTHERM_00442300

Standard Name

ASF1 (Anti-Silencing Factor 1)

Aliases

PreTt05630 | 50.m00199 | 3681.m00058

Description

ASF1 histone chaperone asf1; Anti-silencing protein- ASF1-like containing protein; mediates nuclear transport of newly synthesized histones H3 and H4

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04729 ) Anti-silencing protein, ASF1-like

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12563.1 6.002196208547375e-166
Description: anti-silencing protein, ASF1-like containing protein (251 aa)
Oxytricha Contig22786.0.g13 4.000820122464668e-47
Description: ASF1 like histone chaperone
DictyBase DDB_G0285513 3.0009061039838537e-46
Description: asf1 on chromosome: 4 position 3334165 to 3335058
SGD YJL115W 5.998886722426197e-42
Description: ASF1 Nucleosome assembly factor, involved in chromatin assembly and disassembly, anti-silencing protein that causes derepression of silent loci when overexpressed; plays a role in regulating Ty1 transposition
WormBase WBGene00006817 2.00017271388466e-38
Description: locus:unc-85 Probable histone chaperone asf-1 status:Confirmed UniProt:Q19326 protein_id:CCD69205.1
Stentor Coeruleus SteCoe_15840 3.532628572200807e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:28621664: Akematsu T, Fukuda Y, Garg J, Fillingham JS, Pearlman RE, Loidl J (2017) Post-meiotic DNA double-strand breaks occur in Tetrahymena, and require Topoisomerase II and Spo11. eLife 6( ):
  3. Ref:24120531: Garg J, Lambert JP, Karsou A, Marquez S, Nabeel-Shah S, Bertucci V, Retnasothie DV, Radovani E, Pawson T, Gingras AC, Pearlman RE, Fillingham JS (2013) Conserved Asf1-importin ? physical interaction in growth and sexual development in the ciliate Tetrahymena thermophila. Journal of proteomics 94( ):311-26

Sequences

>TTHERM_00442300(coding)
ATGGCCTTAGTCAACATCTAAAACATCCAATTTCATAACAACCCTTGCCCTTTTTTGAGT
CCCTTTAAACTTGACGTAACCTTCGAATGTATCAAACCTATACCTGATGACATTGAATGG
TAATTAATTTATATTGGTTCTGCTAAAGATGAGAAATACGATTAAGTCCTTGATAAATTC
AGTATTGGGTCATTAGATTAAGGAGTGCTTTAATTTACCATTGAAACAAATCCACCTGAT
CACACTAAGATTCCAAACAAAGATGATTTACTTGGTGTAACTGCTATAATTCTAACTGTT
TCATACCACAATCAGGAGTTTTTCCGTGTTGGATACTATGTCTACAATCAATACAATGAT
CAGGAACTTATTATTAATGATCCTCCTTAAATTCTAATTGATAAGGTTGAGCGTAGTATC
CTTGATAAATAGCCTCGTATCACTCATTTCAACATAAAATGGGGTACTGAGGATGAAAAT
AAAGAAACTGACCCTAATACTTTAGCTATCCTCTAACAGTAATTAGCTTAAAATGGAACC
ATTCCTAATTAACTCATGCAAGAAATGCAATAAGTGAATAGCTAAATGCAATCTTTCTTA
CCTGATCCTTTTTCTAAGTCATCAGGAATACTCTAAGAGTTAACAACATAAGGATAGACT
AACAGCACAAATAGTTTCATGTTTGGTTAAGGGCTAGACATACCTTAAAATAATGCATTC
CAACCTACAAATGTATTCAGTTCTAATCCTTACTGA


>TTHERM_00442300(gene)
ATGGCCTTAGTCAACATCTAAAACATCCAATTTCATAACAACCCTTGCCCTTTTTTGAGT
CCCTTTAAACTTGACGTAACCTTCGAATGTATCAAACCTATACCTGATGACATTGAATGG
TAATTAATTTATATTGGTTCTGCTAAAGATGAGAAATACGATTAAGTCCTTGATAAATTC
AGTATTGGGTCATTAGATTAAGGAGTGCTTTAATTTACCATTGAAACAAATCCACCTGAT
CACACTAAGATTCCAAACAAAGATGATTTACTTGGTGTAACTGCTATAATTCTAACTGTT
TCATACCACAATCAGGAGTTTTTCCGTGTTGGATACTATGTCTACAATCAATACAATGAT
CAGGAACTTATTATTAATGATCCTCCTTAAATTCTAATTGATAAGGTTGAGCGTAGTATC
CTTGATAAATAGCCTCGTATCACTCATTTCAACATAAAATGGGGTACTGAGGATGAAAAT
AAAGAAACTGACCCTAATACTTTAGCTATCCTCTAACAGTAATTAGCTTAAAATGGAACC
ATTCCTAATTAACTCATGCAAGAAATGCAATAAGTGAATAGCTAAATGCAATCTTTCTTA
CCTGATCCTTTTTCTAAGTCATCAGGAATACTCTAAGAGTTAACAACATAAGGATAGACT
AACAGCACAAATAGTTTCATGTTTGGTTAAGGGCTAGACATACCTTAAAATAATGCATTC
CAACCTACAAATGTATTCAGTTCTAATCCTTACTGA


>TTHERM_00442300(protein)
MALVNIQNIQFHNNPCPFLSPFKLDVTFECIKPIPDDIEWQLIYIGSAKDEKYDQVLDKF
SIGSLDQGVLQFTIETNPPDHTKIPNKDDLLGVTAIILTVSYHNQEFFRVGYYVYNQYND
QELIINDPPQILIDKVERSILDKQPRITHFNIKWGTEDENKETDPNTLAILQQQLAQNGT
IPNQLMQEMQQVNSQMQSFLPDPFSKSSGILQELTTQGQTNSTNSFMFGQGLDIPQNNAF
QPTNVFSSNPY