Identifiers and Description

Gene Model Identifier

TTHERM_00442590

Standard Name

BRF1 (Transcription initiation factor TFIIIB, BRF1 subunit)

Aliases

PreTt05659 | 50.m00228 | 3681.m00087

Description

BRF1 transcription factor TFIIB repeat protein; Transcription factor TFIIB repeat family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00382 ) Transcription factor TFIIB repeat
  • ( PF06827 ) Zinc finger found in FPG
  • ( PF06844 ) Protein of unknown function (DUF1244)
  • ( PF07741 ) Brf1-like TBP-binding domain
  • ( PF07754 ) Domain of unknown function (DUF1610)
  • ( PF08271 ) TFIIB zinc-binding
  • ( TIGR00072 ) hydrogenase maturation protease

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12592.1 9.997093137033517e-262
Description: transcription factor TFIIB repeat family protein (579 aa)
Oxytricha Contig17369.0.g57 2.0009381340492598e-66
Description: Transcription factor TFIIB repeat
DictyBase DDB_G0281215 1.0003292389192957e-45
Description: brf1 on chromosome: 3 position 4228761 to 4230881
SGD YGR246C 2.9986404383886433e-43
Description: BRF1 TFIIIB B-related factor, one of three subunits of RNA polymerase III transcription initiation factor TFIIIB, binds TFIIIC and TBP and recruits RNA pol III to promoters, amino-terminal half is homologous to TFIIB
WormBase WBGene00000271 9.999888128184441e-42
Description: locus:brf-1 status:Partially_confirmed UniProt:Q20429 protein_id:CCD66264.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00442590(coding)
ATGATAGATACAATAGATTACAAATCAAATAAGCAAGTTTGTAAAAAGTGTGGTCATGTT
AATTATGATCTAGACGGTGATGAAGCAGACCAATAAAAATGCAGAAATTGTGGTTTTGTT
ATGTATGAAAACTGCTTCGAATCAGGTATTCAATTTACTGATACCAAGATCGATGGCTAG
TTGCACGATATGTCTAACTTTGGAAGAGATAATACTAAGTATGCTGAAGAATGCATAGCT
ACAATGATAAGAGATTTAAAAATAAAAAGCGAATACCCAGATTATTTAGAAAGAATTGGC
GAAACGCCTTTGAGAATCATGAAATTTGCATATAAAGCTTACTTTTTAGATCACGGTTCA
AATATACATCATTATTCTGCCGCTGCCCTTTATATAGCATTAAGATTTTAAAAGGCTCCC
TTTTTACTTATGGATTTTTCAGAAAAACTTTGCATAAATCTTTTCAAGCTCGCAAGATGC
TATAGAAAATTAGCTAAATTTTTAAATGTAACTCTTAAATTAAATGAAAGACTCCCTTCA
ATAGATCCATCAATTTATATTCCACGTTTTTGCAAGATGCTAGAATTTAATGATAAAGTT
GATTAAGTTAAGGAAACAGCTATCAAACTTTTAAAAAGAATGAAATTGGATTGGATGAGT
CATGGTCGTCGACCAAGTTCTTTGTGTGGTGCTGCCATTTTAATTGCTGCAAGAATGCAT
GGATTTAAGAGAACTACTAGTGAAGTTTGCAAAGTAGTTTATGTTTGTGAAGAAACCTTA
AGAAAAAGATTAGAAGAATTCAAAGAAACAGATGTTGCCAAATTAACAAGAGAAAAATTC
GATGAAATTTAAGATATAGAGTTGATGGGAAGGGAGCGTGATCCTCCTGCTTTCATAAAG
GCTTTAAAAAATTAATAAGAAACTTTAAAAAAAATAAAACCAAATGAAGAAAATGATGAT
GAAATAAATAAACAATTAGAAGATGCAGCAAATATCATAGAGACTCAAGTTAAGTCTACC
AGTAACGAGGGATAATAAGTAAATTAAGATTATGAAATGAGTGATGATATTTCTATTGGA
GATGATGAAGAAGATGAGGGTGAAAATAGTAAATAATAAAATGGAGAAGAGTAGAAAAAG
CAACTTAAGCCTTTATCAGAATCTGAAAGATAAGTCAAAACTTTAGTAAAAAAAGAAGAT
GCTAAATAAATTGGAATTATTAATGAGAATGGTTATTCCTTAAATGTTAGAGAAGATTTA
TCAGATATGAGTGAAGAAGATGTAAATCAATTTATACTCACTAATGAAGAACATACTGTT
AAAAGTATCATATGGCACAGTATGAATGAAACCTGGTTGAGGGAATAATAAAGAAAGGAT
CCAAAAGAAGAAAAAAAAGAATGCAAAAAAAGAAACAAAAGAAGAAATGATTAACTTATG
AATGAAGATGACCCAGTAGATGCCTTATTTAAAAGTAAAAAAATTAGAGAAAAGCTAGAT
GAAAAGAAGGTTCGTGATATGTTCTTATAAATAGAAAAAGTTAAAATGACACAATTGACA
GATATCTTCACAACAGATAAGCCACCTGCTGAATCGCTTGAAACTACATAAAAAATGATA
TACAATAGCGAACTAATTGTTTGCAATGGCCCTATTGATTACATGAATAGATATGGAGCT
AGTAACGATCAGAGCACTCGTGATGCTCCTCAAATAGATCATGATGAAGATGGATTTGAG
TATGATTGA


>TTHERM_00442590(gene)
ATGATAGATACAATAGATTACAAATCAAATAAGCAAGTTTGTAAAAAGTGTGGTCATGTT
AATTATGATCTAGACGGTGATGAAGCAGACCAATAAAAATGCAGAAATTGTGGTTTTGTT
ATGTATGAAAACTGCTTCGAATCAGGTATTCAATTTACTGATACCAAGATCGATGGCTAG
TTGCACGATATGTCTAACTTTGGAAGAGATAATACTAAGTATGCTGAAGAATGCATAGCT
ACAATGATAAGAGATTTAAAAATAAAAAGCGAATACCCAGATTATTTAGAAAGAATTGGC
GAAACGCCTTTGAGAATCATGAAATTTGCATATAAAGCTTACTTTTTAGATCACGGTTCA
AATATACATCATTATTCTGCCGCTGCCCTTTATATAGCATTAAGATTTTAAAAGGCTCCC
TTTTTACTTATGGATTTTTCAGAAAAACTTTGCATAAATCTTTTCAAGCTCGCAAGATGC
TATAGAAAATTAGCTAAATTTTTAAATGTAACTCTTAAATTAAATGAAAGACTCCCTTCA
ATAGATCCATCAATTTATATTCCACGGTAATACTCTACACAAACAAACAAATAAATACTC
ACATTAGTGCTATTTATCAAATTTCTATGCTAATTTCTTATTTAATTTTTTAACTTGAGC
GCTTTTTTTCATTTAATGAAAAGCGTCTACAGTGTTATTTATCATAAAGAAATAAATCTA
TAAAAAATATTATTTATATTAAATTCTTATATTAGCAAAGAAAGAATGTGTGTGTATTTA
ACGAATCTTATTTATTTTATTAATAAAAATGTTTTATTTTGTTTATAAATATTACAGTTT
TTGCAAGATGCTAGAATTTAATGATAAAGTTGATTAAGTTAAGGAAACAGCTATCAAACT
TTTAAAAAGAATGAAATTGGATTGGATGAGTCATGGTCGTCGACCAAGTTCTTTGTGTGG
TGCTGCCATTTTAATTGCTGCAAGAATGCATGGATTTAAGAGAACTACTAGTGAAGTTTG
CAAAGTAGTTTATGTTTGTGAAGAAACCTTAAGAAAAAGATTAGAAGAATTCAAAGAAAC
AGATGTTGCCAAATTAACAAGAGAAAAATTCGATGAAATTTAAGATATAGAGTTGATGGG
AAGGGAGCGTGATCCTCCTGCTTTCATAAAGGCTTTAAAAAATTAATAAGAAACTTTAAA
AAAAATAAAACCAAATGAAGAAAATGATGATGAAATAAATAAACAATTAGAAGATGCAGC
AAATATCATAGAGACTCAAGTTAAGTCTACCAGTAACGAGGGATAATAAGTAAATAATAA
TATAAATAATATAAATAATCCAAGTATTTTAAATAAATTTTATCAAATCATATTGATTTA
GGTAAATTAAGATTATGAAATGAGTGATGATATTTCTATTGGAGATGATGAAGAAGATGA
GGGTGAAAATAGTAAATAATAAAATGGAGAAGAGTAGAAAAAGCAACTTAAGCCTTTATC
AGAATCTGAAAGATAAGTCAAAACTTTAGTAAAAAAAGAAGATGCTAAATAAATTGGAAT
TATTAATGAGAATGGTTATTCCTTAAATGTTAGAGAAGATTTATCAGATATGAGTGAAGA
AGATGTAAATCAATTTATACTCACTAATGAAGAACATACTGTTAAAAGTATCATATGGCA
CAGTATGAATGAAACCTGGTTGAGGGAATAATAAAGAAAGGATCCAAAAGAAGAAAAAAA
AGAATGCAAAAAAAGAAACAAAAGAAGAAATGATTAACTTATGAATGAAGATGACCCAGT
AGATGCCTTATTTAAAAGTAAAAAAATTAGAGAAAAGCTAGATGAAAAGAAGGTTCGTGA
TATGTTCTTATAAATAGAAAAAGTTAAAATGACACAATTGACAGATATCTTCACAACAGA
TAAGCCACCTGCTGAATCGCTTGAAACTACATAAAAAATGATATACAATAGCGAACTAAT
TGTTTGCAATGGCCCTATTGATTACATGAATAGATATGGAGCTAGTAACGATCAGAGCAC
TCGTGATGCTCCTCAAATAGATCATGATGAAGATGGATTTGAGTATGATTGA


>TTHERM_00442590(protein)
MIDTIDYKSNKQVCKKCGHVNYDLDGDEADQQKCRNCGFVMYENCFESGIQFTDTKIDGQ
LHDMSNFGRDNTKYAEECIATMIRDLKIKSEYPDYLERIGETPLRIMKFAYKAYFLDHGS
NIHHYSAAALYIALRFQKAPFLLMDFSEKLCINLFKLARCYRKLAKFLNVTLKLNERLPS
IDPSIYIPRFCKMLEFNDKVDQVKETAIKLLKRMKLDWMSHGRRPSSLCGAAILIAARMH
GFKRTTSEVCKVVYVCEETLRKRLEEFKETDVAKLTREKFDEIQDIELMGRERDPPAFIK
ALKNQQETLKKIKPNEENDDEINKQLEDAANIIETQVKSTSNEGQQVNQDYEMSDDISIG
DDEEDEGENSKQQNGEEQKKQLKPLSESERQVKTLVKKEDAKQIGIINENGYSLNVREDL
SDMSEEDVNQFILTNEEHTVKSIIWHSMNETWLREQQRKDPKEEKKECKKRNKRRNDQLM
NEDDPVDALFKSKKIREKLDEKKVRDMFLQIEKVKMTQLTDIFTTDKPPAESLETTQKMI
YNSELIVCNGPIDYMNRYGASNDQSTRDAPQIDHDEDGFEYD