Identifiers and Description

Gene Model Identifier

TTHERM_00444250

Standard Name

RPC11 (RNA polymerase III complex subunit Rpc11 )

Aliases

PreTt03793 | 51.m00159 | 3704.m00014

Description

RPC11 DNA-directed RNA polymerase subunit; RNA polymerase III complex subunit; DNA-directed RNA polymerase subunit/transcription factor S

Genome Browser (Macronucleus)

Full Screen View

No Genome Browser Data Present

Genome Browser (Micronucleus)

Full Screen View

No Genome Browser Data Present

External Links

• Uniprot
• Alphafold

Gene Ontology Annotations

Cellular Component

• alpha5-beta1 integrin-osteopontin complex (IEA) | GO:0071128
• CURI complex (IEA) | GO:0032545
• EGFR-Grb2-Sos complex (IEA) | GO:0070620
• growth cone membrane (IEA) | GO:0032584
• ionotropic glutamate receptor complex (IEA) | GO:0008328

Molecular Function

• 11-deoxycorticosterone binding (IEA) | GO:1903878
• 17alpha-hydroxyprogesterone binding (IEA) | GO:1903880
• 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity (IEA) | GO:0008413
• all-trans retinol 3,4-desaturase activity (IEA) | GO:0061896
• cysteine-type deubiquitinase activity (IEA) | GO:0004843
• MHC class II receptor activity (IEA) | GO:0032395
• microtubule severing ATPase activity (IEA) | GO:0008568
• obsolete sodium-transporting two-sector ATPase activity (IEA) | GO:0015443
• oligoxyloglucan reducing-end-specific cellobiohydrolase activity (IEA) | GO:0033945
• phosphatidylcholine:cardiolipin O-linoleoyltransferase activity (IEA) | GO:0032577
• phosphatidylserine decarboxylase activity (IEA) | GO:0004609
• phosphoenolpyruvate carboxykinase (ATP) activity (IEA) | GO:0004612
• phosphoenolpyruvate carboxykinase activity (IEA) | GO:0004611
• proteinase activated receptor binding (IEA) | GO:0031871
• sphingomyelin phosphodiesterase activity (IEA) | GO:0004767

Biological Process

• 2-methylbut-2-enoyl-CoA(4-) catabolic process (IEA) | GO:1902193
• 2-methylbut-2-enoyl-CoA(4-) metabolic process (IEA) | GO:1902192
• basement membrane organization (IEA) | GO:0071711
• blood coagulation, extrinsic pathway (IEA) | GO:0007598
• blood coagulation, intrinsic pathway (IEA) | GO:0007597
• cell wall modification involved in fruit ripening (IEA) | GO:0009829
• cellular response to diacyl bacterial lipopeptide (IEA) | GO:0071726
• coenzyme A metabolic process (IEA) | GO:0015936
• embryo implantation (IEA) | GO:0007566
• endoderm development (IEA) | GO:0007492
• epiboly involved in gastrulation with mouth forming second (IEA) | GO:0055113
• female pregnancy (IEA) | GO:0007565
• heme A biosynthetic process (IEA) | GO:0006784
• heme biosynthetic process (IEA) | GO:0006783
• high-affinity zinc II ion transport (IEA) | GO:0006830
• immunoglobulin heavy chain V-D-J recombination (IEA) | GO:0071707
• internal genitalia morphogenesis (IEA) | GO:0035260
• learning or memory (IEA) | GO:0007611
• mesodermal cell fate determination (IEA) | GO:0007500
• midgut development (IEA) | GO:0007494
• mitochondrial membrane organization (IEA) | GO:0007006
• negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902647
• negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902642
• negative regulation of chemokine (C-C motif) ligand 20 production (IEA) | GO:1903885
• negative regulation of complement-dependent cytotoxicity (IEA) | GO:1903660
• negative regulation of epithelial cell-cell adhesion involved in epithelium migration (IEA) | GO:1903682
• negative regulation of macrophage derived foam cell differentiation (IEA) | GO:0010745
• negative regulation of PERK-mediated unfolded protein response (IEA) | GO:1903898
• negative regulation of sprouting angiogenesis (IEA) | GO:1903671
• neural crest cell migration involved in sympathetic nervous system development (IEA) | GO:1903045
• neutral lipid metabolic process (IEA) | GO:0006638
• Notch signaling pathway involved in camera-type eye photoreceptor fate commitment (IEA) | GO:0060227
• obsolete age-dependent yeast cell size increase (IEA) | GO:0007581
• obsolete MAPK cascade involved in ascospore formation (IEA) | GO:1903695
• obsolete mRNA endonucleolytic cleavage involved in unfolded protein response (IEA) | GO:0070055
• obsolete negative regulation of SMAD protein complex assembly (IEA) | GO:0010991
• obsolete regulation of histone H3-K27 methylation (IEA) | GO:0061085
• obsolete RING-like zinc finger domain-mediated complex assembly (IEA) | GO:0071536
• obsolete senescence factor accumulation (IEA) | GO:0007579
• obsolete small molecule transport (IEA) | GO:0006832
• obsolete sodium/potassium transport (IEA) | GO:0006815
• ommochrome biosynthetic process (IEA) | GO:0006727
• parturition (IEA) | GO:0007567
• phagocytosis (IEA) | GO:0006909
• photoreceptor cell morphogenesis (IEA) | GO:0008594
• plant-type cell wall modification (IEA) | GO:0009827
• positive regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902643
• positive regulation of aconitate hydratase activity (IEA) | GO:1904234
• positive regulation of bacterial-type flagellum assembly (IEA) | GO:1902210
• positive regulation of macrophage derived foam cell differentiation (IEA) | GO:0010744
• positive regulation of oxidative phosphorylation (IEA) | GO:1903862
• positive regulation of phospholipid translocation (IEA) | GO:0061092
• positive regulation of response to water deprivation (IEA) | GO:1902584
• pronuclear fusion (IEA) | GO:0007344
• propan-2-ol biosynthetic process (IEA) | GO:1902640
• protein localization to old growing cell tip (IEA) | GO:1903858
• prothoracic disc morphogenesis (IEA) | GO:0007470
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902646
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902641
• regulation of chitin-based cuticle tanning (IEA) | GO:0007564
• regulation of complement-dependent cytotoxicity (IEA) | GO:1903659
• regulation of cytokinin dehydrogenase activity (IEA) | GO:1903856
• regulation of germ cell proliferation (IEA) | GO:1905936
• regulation of phosphorus utilization (IEA) | GO:0006795
• sensory perception (IEA) | GO:0007600
• short-term memory (IEA) | GO:0007614
• snoRNA guided rRNA 2'-O-methylation (IEA) | GO:0000452
• sodium-independent prostaglandin transport (IEA) | GO:0071720
• terpenoid indole alkaloid biosynthetic process (IEA) | GO:0009709
• tertiary alcohol biosynthetic process (IEA) | GO:1902645
• vesicle coating (IEA) | GO:0006901
• zinc ion transport (IEA) | GO:0006829

Domains

• ( PF01096 ) Transcription factor S-II (TFIIS)
• ( PF02150 ) RNA polymerases M/15 Kd subunit

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

No results were calculated for this gene in GeneMania.

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444250(coding)
ATGAATTTCTGTCCTTTATGCGCTAATGCTCTTATTATTCAGAATGTTGGAGGAAATAAT
AGATTTTCTTGTAGAACATGTACATATTTTTATCCACTACTAAAGAAAATAGAAACAGTA
ACATACTCTAGAATGGTTAAAGATGATACTATTCATGATATTTCTCTATAAAAAGAATCT
CTATAAACTGATAAAGATATGATTTGCCCTGCTTGTGAGAAGAGAGGTGCCTATATAAGA
CTGGAATAAGATAGAAGTCTTGATGAAGGCTAAACATAACATTATATTTGTAAAAATTGC
TCACATACTTGGAAAGATATGGGGTGA

>TTHERM_00444250(gene)
AAAACTTGTAAATAACAGCATCTATTAGACTCTAGTTTATTTTAAGATATTAATTAGCCT
TTGTTTGTTAAGAATAAATATATATTAATATATTTTTTATCACTTTTTAAAGATATTTTT
AGAAGAATAAGCTAGATTTAAATAATTTGAACAAAAACTGCGAAATCGCAATTTAGATTA
ATAAAAATATTTAACTAACATCTGAAGAAAATTTAAGATGAATTTCTGTCCTTTATGCGC
TAATGCTCTTATTATTCAGAATGTTGGAGGAAATAATAGATTTTCTTGTAGAACATGTAC
ATATTTTTATCCACTACTAAAGAAAATAGAAACAGTAACATACTCTAGAATGGTTAAAGA
TGATACTATTCATGATATTTCTCTATAAAAAGAATCTCTATAAACTGATAAAGATATGAT
TTGCCCTGCTTGTGAGAAGAGAGGTGCCTATATAAGACTGGAATAAGATAGAAGTCTTGA
TGAAGGCTAAACATAACATTATATTTGTAAAAATTGCTCACATACTTGGAAAGATATGGG
GTGATTTTTAGCTATTTATAAAATTTATATTGTAATTTAATGTAAAAAATAATATTTTCA
GCAATTAAGTATATTAATTTAATTCAAATAAATTCTATTCGTTCAAAATGCATTCTTTAA
GAGACTAAATAGCTAAATACTTGAAAATAAAA

>TTHERM_00444250(protein)
MNFCPLCANALIIQNVGGNNRFSCRTCTYFYPLLKKIETVTYSRMVKDDTIHDISLQKES
LQTDKDMICPACEKRGAYIRLEQDRSLDEGQTQHYICKNCSHTWKDMG