Identifiers and Description

Gene Model Identifier

TTHERM_00444260

Standard Name

FDD2 (Fatty acid Desaturase Domain)

Aliases

PreTt03794 | 51.m00160 | 3704.m00015

Description

FDD2 fatty acid desaturase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10933.1 9.997093137033517e-262
Description: fatty acid desaturase (406 aa)
Oxytricha Contig9505.0.g59 7.00270765106311e-74
Description: Fatty acid desaturase
Stentor Coeruleus SteCoe_11266 1.9792598779469045e-32
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444260(coding)
ATGGCTATCACTGTTGTCAATCCTAACGGTCATCGCTCTCTTTAACCTTTTTATAAGGGA
GAAGAAATGATTTTGTTTAGTTCTATACAATACTATTTAGTTCCTTTTATTTACTGTTTA
GGTTATCTAGGAGTTATGTACTTACACAATCCTTACCTATTGATTTTTATTGCTTATTCT
CTAATCCCTTTTTTGGACTCATTTTTTAACTTTGATCTTAGAAATCCTACAAAAGAAGAG
TAGAAGTAACTTGAAGGTAAGCTTCGCTTTAAAATCCCACTCTATTTTGCTGTACTTACT
GAGTGGATTTTCTCAACTTGGATCATTTACTATGTCACATAAAATAGCTAAAATATCAGC
TTATTTAACTTAATTGGTATTATATTTCTTACAGGTAATGGCTCTGCTTCAAATATCAAT
GTAGCTCATGAGCTCTTCCATAAAACAGGTTTGCTAGACAAATTCTTTGGTACATTCACA
CTTGCAAAGAATCTATACATGCATTTCACAATAGAACACTAATATGGTCATCATAGAAAC
GTTTCTACCCCCAATGACCCTGCTACTTCAAGATATGGGTAGACATTATATGAATACCTC
CCTTAAACCATCATTGGTTCTTATTTTAGTGCTTGGAGAATAGAAAATAAATTCTAACGT
TTATAAGGAAGACACCCTTTTAATCCATTCAATAAAATGATTATTTATACCATTCTCTAC
TTCATTATTCCATACATTCATTATCTAGTATTTGGTTTATATGGAATGTTCTTTTTCTTG
TGCACAGCTTTTATTTCAGTAATTTATTTAGAGGCTATTAACTACATTGAGCACTATGGT
TTAATGAGAGAAAAAACTGAAGATGGACATTACGAAAAAGTTGATATTAGACATTCATGG
AACGCACCTCATAGATTTTCTAACTATCTCTTATTTAAGCTCTAAAGACACTCAGATCAC
CATGAAAACGGATATAAGGAATACTAAACTCTCTGTAGTTATACTGATAGTCCGACCCTT
CCTCATGGATATCCAGTTTGCATTTTAATTAGTTTCTATCCTCCACTATGGTTCGAAATA
ATGCACGAAGTACTCGAATCTTATAAAAAAGAAAAGAAATCAATACCATTACCCAACATA
GAAAAAAAGATAGATAATTACACTTAAAAAGTGTCTTTAATTACAATGACCCTTTCAGTT
TTATCATTTTTTATTTGA


>TTHERM_00444260(gene)
ATGGCTATCACTGTTGTCAATCCTAACGGTCATCGCTCTCTTTAACCTTTTTATAAGGGA
GAAGAAATGATTTTGTTTAGTTCTATACAATACTATTTAGTTCCTTTTATTTACTGTTTA
GGTTATCTAGGAGTTATGTACTTACACAATCCTTACCTATTGATTTTTATTGCTTATTCT
CTAATCCCTTTTTTGGACTCATTTTTTAACTTTGATCTTAGAAATCCTACAAAAGAAGAG
TAGAAGTAACTTGAAGGTAAGCTTCGCTTTAAAATCCCACTCTATTTTGCTGTACTTACT
GAGTGGATTTTCTCAACTTGGATCATTTACTATGTCACATAAAATAGCTAAAATATCAGC
TTATTTAACTTAATTGGTATTATATTTCTTACAGGTAATGGCTCTGCTTCAAATATCAAT
GTAGCTCATGAGCTCTTCCATAAAACAGGTTTGCTAGACAAATTCTTTGGTACATTCACA
CTTGCAAAGAATCTATACATGCATTTCACAATAGAACACTAATATGGTCATCATAGAAAC
GTTTCTACCCCCAATGACCCTGCTACTTCAAGATATGGGTAGACATTATATGAATACCTC
CCTTAAACCATCATTGGTTCTTATTTTAGTGCTTGGAGAATAGAAAATAAATTCTAACGT
TTATAAGGAAGACACCCTTTTAATCCATTCAATAAAATGATTATTTATACCATTCTCTAC
TTCATTATTCCATACATTCATTATCTAGTATTTGGTTTATATGGAATGTTCTTTTTCTTG
TGCACAGCTTTTATTTCAGTAATTTATTTAGAGGCTATTAACTACATTGAGCACTATGGT
TTAATGAGAGAAAAAACTGAAGATGGACATTACGAAAAAGTTGATATTAGACATTCATGG
AACGCACCTCATAGATTTTCTAACTATCTCTTATTTAAGCTCTAAAGACACTCAGATCAC
CATGAAAACGGATATAAGGAATACTAAACTCTCTGTAGTTATACTGATAGTCCGACCCTT
CCTCATGGATATCCAGTTTGCATTTTAATTAGTTTCTATCCTCCACTATGGTTCGAAATA
ATGCACGAAGTACTCGAATCTTATAAAAAAGAAAAGAAATCAATACCATTACCCAACATA
GAAAAAAAGATAGATAATTACACTTAAAAAGTGTCTTTAATTACAATGACCCTTTCAGTT
TTATCATTTTTTATTTGA


>TTHERM_00444260(protein)
MAITVVNPNGHRSLQPFYKGEEMILFSSIQYYLVPFIYCLGYLGVMYLHNPYLLIFIAYS
LIPFLDSFFNFDLRNPTKEEQKQLEGKLRFKIPLYFAVLTEWIFSTWIIYYVTQNSQNIS
LFNLIGIIFLTGNGSASNINVAHELFHKTGLLDKFFGTFTLAKNLYMHFTIEHQYGHHRN
VSTPNDPATSRYGQTLYEYLPQTIIGSYFSAWRIENKFQRLQGRHPFNPFNKMIIYTILY
FIIPYIHYLVFGLYGMFFFLCTAFISVIYLEAINYIEHYGLMREKTEDGHYEKVDIRHSW
NAPHRFSNYLLFKLQRHSDHHENGYKEYQTLCSYTDSPTLPHGYPVCILISFYPPLWFEI
MHEVLESYKKEKKSIPLPNIEKKIDNYTQKVSLITMTLSVLSFFI