Identifiers and Description

Gene Model Identifier

TTHERM_00444310

Standard Name

DRH20 (DExD/H box RNA helicase 20)

Aliases

PreTt03799 | 51.m00165 | 3704.m00020

Description

DRH20 ATP-dependent RNA helicase DHX8

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF00575 ) S1 RNA binding domain
  • ( PF04408 ) Helicase associated domain (HA2)
  • ( PF04642 ) Protein of unknown function, DUF601
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF07717 ) Domain of unknown function (DUF1605)
  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large
  • ( TIGR01967 ) ATP-dependent helicase HrpA
  • ( TIGR01970 ) ATP-dependent helicase HrpB

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_18422 0
Description: None
WormBase WBGene00003393 9.997093137033517e-262
Description: locus:mog-5 Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 status:Confirmed UniProt:Q09530 protein_id:CCD68732.1
Tetrahymena borealis EI9_10926.1 9.997093137033517e-262
Description: ATP-dependent helicase DHX8, RNA helicase HRH1 (1308 aa)
DictyBase DDB_G0291183 9.997093137033517e-262
Description: dhx8 on chromosome: 5 position 5107365 to 5110847
Oxytricha Contig13549.0.g40 9.997093137033517e-262
Description: Oligonucleotide/oligosaccharide-binding (OB)-fold
SGD YER013W 9.997093137033517e-262
Description: PRP22 DEAH-box RNA-dependent ATPase/ATP-dependent RNA helicase, associates with lariat intermediates before the second catalytic step of splicing; mediates ATP-dependent mRNA release from the spliceosome and unwinds RNA duplexes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444310(coding)
ATGGCTTCTAATTTATAGTATGTCCTTCTCAGCTAGCAGGTTATGCAACAGCTGAAAACA
CAACTAGGAATTTAGGATAAAGATTTAGTAGATTATTTTATAGATTAAGCATTTGAATCA
GATACTGAGCAATAGTTTGCTGAAAATATTAAAGATGATGCAGAATTATCAGACTAATTT
ATTTCTAGTTTATATAAATTGATTAAGTCAAAGTAGAGCTTAATTAAACCGAAAGTTGAT
CTTCAAGCATAAAATAAATAACTTGAGGACAAGAAAAATAAATTTTCTGCAGGAGATCCA
TAAAAAATTGATATTGAAATCGAAAAAGAGGATATCAAGCAAAAAGAAAAGGTTAAAAGA
GATGAAAATTATGAAAATGAAGATAGTGATGAAGAATAGAATGAATTAAAAAGACAAGAA
CTAGAAAAGAGAAAGCAATATGCTAAAATTTTCCCAGCTCTTGCATAGAGAGATGAAATA
GATCTGGATTAACCTTAACCAGAGTAAAAAGTGGACAAAAATAGTAGTAAATTCGATCCA
AAGCCGACTAATATTGATGCAAGATAAGAAAAAGAAAAAGAGACTTCAAATAAAGAAATC
AGTAGAAAAAAAAGTAGCAAGCATTCAAGAAGCAGAAGCAAGTCTCATAAAAAGGAAAAA
AGTAAAAGAAGGTCTAGAAGTCGCTCATAAGGTAAAAGTAAGAAGAAATACTCTAGAAGT
AGGTCAAAAGAAAAAAAAAATCGCTCTTATTCAAAAGAAAAGAAAAGTCGTCGTTCACGC
TCTAAATCTCATGAAAAAAAGAAAAAAAGGGATTCCCCTGATGCAAAAAAAGATCATAGA
AAAAAATATTAGAGAGATTCGAATTCACCACTCAGAGAGAAAAAGGGTAGAGAAAATAGT
TCTCGCAGCAGATCATAAGAAAAGCAAACTCGTTAGCAATTCAAGAGATAAGAAGTTGAA
AAGGACTCAATTTTAGATGGAGTTGTTTCTAAAATAAGTGAATTTGGTTGTTTTGTAACA
TTAGAAAATGTTGGAGGGCGTAAAGAAGGTTTGGTTCACATTAGCTAGCTTTCAAGCAAA
AGAGTTGGAAATATTTAAGAAGTAGCGAGAATTGGATAAAGAGTAAAAGTAAAAGTAATA
AGTGTGATAGGAAACAAAATTAGTTTGAGTATGAAAGATGTTGATTAAATAACTGGTTTA
GATAAGTTTGAACAAAAAATACGATATGAGGAATCCTAATCTCTCAAGTATGACCCTCTT
GAGTAGAAAGAAAAGAAGGCATTTGGTGTGTTAGATAAAGATGATATTATCAAATCAAAT
TAAAATTCAAAGTTCGGTGCTCTAACAGGTATTCTACTTGAAGATAAAGAGGAAAAAAAT
AAAAAGAGAATCAGAGAAAGTTCTTAAGAAAAGTGGGAACGTAAGTAAGCAGAATACTAT
TCCAGTAAACATTTGGGTATTGATAAAGGCGAAATAGATTTAGATGAAGGTTGTTCAGAA
GATGAAGATGTTGAAGTTGAAATTCGTGAGAACGAAACTCCCTTCTTAAAAGATACGACA
ACAAAGGCAGGAGTAAACTTATCTCCTATTAGAGTTACTAAAAACTAGAATGGCTCTTTG
AGTAGACAAGCACTTAATGCAGTTTAACAAGCAAAAGATAGAAGAGAAATTCGTATTTAG
CAAAACAATGCTTTGGTAGATAGTATTAACAAATAAGAACTCTAAAAAATGAATTTAGAT
CCTACTGCAGAATCTATTTTCCTTTTAAGTAATTTAAAGAAGTTGGGAGATGCTTAAACA
TCGGAAATTCCAGAATTTAAAAAAGAAGCAATGTTTAAGGCTGCTCTCAACAACTCTAAC
AAACCAAAATAAACTATGACAATCAAGGAGTAAAAAGAATCTCTTCCTATCTATTAATAT
AAGGAATAACTTATCAAAGCTTGCATTAATAATTAAATTCTTATTGTTATTGGTGAAACC
GGTTCAGGAAAAACAACTTAAATGACATAGTATCTCTTAGAAGCAGGCTTTTGTAAGAGT
GGTAAGAAAATTGGGTGTACCTAACCTCGTCGTGTTGCAGCTATGAGTGTTGCTAAGCGT
GTTTCTGAAGAAATGGGTGTAGTACTTGGTGAAGAAGTAGGTTATTCAATACGTTTTGAA
GATTGTACATCTGCTTCTACAGTAATTAAATATATGACTGATGGTATGCTTCTTCGTGAG
GCCTTGCTTGACACAGAACTAAGCAACTACTCAGTTATTATGCTCGATGAAGCACATGAA
AGATAGCTAAATACAGATGTTCTTTTTGGTTTACTTAAGAAAGTAGCTAAGAAAAGAAAA
GATTTTCATTTGATTATTACTTCCGCTACCCTTGATGCTGCAAAATTCTCTAATTATTTC
TTTGATTGCTAAGTTTTCCGTGTACCAGGTCGTACCTTCAAAGTCGATGTCCTCTACTCT
GTAGAACCTGAATAGGATTATGTTGAAGCTTCTTTAATTGTAATCATGCAAATTCACTTG
CATGAACCTCCTGGCGATATTCTCCTTTTCTTAACAGGTCAAGAAGAAATTGATAATGCA
TGCTAAATATTATTCTAGCGTATGAAGAACTTAGGTCCAGATGCACCTGAACTTATTATA
TTACCTCTTTATGCTGGTTTGCCTAATGAACTATAGAATAGAATTTTCCTTCCTACTCCT
GAGGGAAAACGTAAATGTATTATATCAACTAATATTGCAGAAGCATCTCTTACCATCGAT
GGTATTTACTATGTCGTAGATCCAGGATTTGCAAAAATTAAAGTTTACAATCCAAAACTT
GGTATGGATTCCTTGATTGTTGCACCAATTTCATAGGCTTCAGCGAAATAACGTTAGGGT
CGTGCAGGTCGTACAGGTCCTGGTAAATGTTTCCGTCTTTATACTGAAGATGCTTTCAAA
AATGAAATGCTCCCAACAAGTATACCTGAAATTCAGCGTACAAACTTAGCAAACACGGTT
TTACTTTTAAAGGCAATGGGTATTAATGATTTAATCAACTTCGATTTTATGGATCCTCCT
CCTATTCAAACTTTGATTTCTGCTTTAGAACATCTTTACACTTTAGGTTGTTTGGATGAT
GAAGGTCTCCTTACACGTCTCGGTTTGAAAATGGCCGAATTTCCTTTAGAACCACCTCTC
TCTAAAATGCTTATAACAAGTGTTGATCTTGGATGTTCAGATGAAATAGCTACTATTATT
GCTATGTTGTCAGTTTAAAATGTATTTTTCTGTCCAAAAGATAAAAAATAACAAGCTGAC
CAGCGTCGTGCTAAATTTCATCATTAAGATGGAGACCACTTAACTCTTTTGACTGTATAC
GAAGCTTGGAAATCAAACAATTTTTCAAATATTTGGTGTCATGAGAATTTCATAGATTCT
AGAACAATAAAAAGAGCACAAGATATTCGTAAACAGTTGATAGGTATCATGGACCGCTAT
CATTTACCTGTTTAATCGTGTGGTAAAAATTATGCCAAAATCCGTAAGGCTATATGTGCA
GGCTTCTTTAATCATGCAGCAAAAAAAGATCGTAACGAAGGATACAAAACTATCATAGAT
AATCATACTGTTAACATACATCCTACATCTGCACTTTTTTAGAAGCAGCCGGATTGGGTA
GTTTATCACGAATTAGTTTTGACAACTAAAGAATATATGAGAAATATTTCCACAATAGAA
CCAAAGTGGCTTGTTGAAGTTGCACCGAATTTCTTTTAAAACGTAAACCCTCATGTATTA
TCAAAAGCTAAAAAGGCTGAAAAGCTTGAATCACTCTCAACTAAAAGTGGTGATAACGAA
GCTTGGCGTCTGTCTAAAAGAAGAGGAAATGGTTGA


>TTHERM_00444310(gene)
ATGGCTTCTAATTTATAGTATGTCCTTCTCAGCTAGCAGGTTATGCAACAGCTGAAAACA
CAACTAGGAATTTAGGATAAAGATTTAGTAGATTATTTTATAGATTAAGCATTTGAATCA
GATACTGAGCAATAGTTTGCTGAAAATATTAAAGATGATGCAGAATTATCAGACTAATTT
ATTTCTAGTTTATATAAATTGATTAAGTCAAAGTAGAGCTTAATTAAACCGAAAGTTGAT
CTTCAAGCATAAAATAAATAACTTGAGGACAAGAAAAATAAATTTTCTGCAGGAGATCCA
TAAAAAATTGATATTGAAATCGAAAAAGAGGATATCAAGCAAAAAGAAAAGGTTAAAAGA
GATGAAAATTATGAAAATGAAGATAGTGATGAAGAATAGAATGAATTAAAAAGACAAGAA
CTAGAAAAGAGAAAGCAATATGCTAAAATTTTCCCAGCTCTTGCATAGAGAGATGAAATA
GATCTGGATTAACCTTAACCAGAGTAAAAAGTGGACAAAAATAGTAGTAAATTCGATCCA
AAGCCGACTAATATTGATGCAAGATAAGAAAAAGAAAAAGAGACTTCAAATAAAGAAATC
AGTAGAAAAAAAAGTAGCAAGCATTCAAGAAGCAGAAGCAAGTCTCATAAAAAGGAAAAA
AGTAAAAGAAGGTCTAGAAGTCGCTCATAAGGTAAAAGTAAGAAGAAATACTCTAGAAGT
AGGTCAAAAGAAAAAAAAAATCGCTCTTATTCAAAAGAAAAGAAAAGTCGTCGTTCACGC
TCTAAATCTCATGAAAAAAAGAAAAAAAGGGATTCCCCTGATGCAAAAAAAGATCATAGA
AAAAAATATTAGAGAGATTCGAATTCACCACTCAGAGAGAAAAAGGGTAGAGAAAATAGT
TCTCGCAGCAGATCATAAGAAAAGCAAACTCGTTAGCAATTCAAGAGATAAGAAGTTGAA
AAGGACTCAATTTTAGATGGAGTTGTTTCTAAAATAAGTGAATTTGGTTGTTTTGTAACA
TTAGAAAATGTTGGAGGGCGTAAAGAAGGTTTGGTTCACATTAGCTAGCTTTCAAGCAAA
AGAGTTGGAAATATTTAAGAAGTAGCGAGAATTGGATAAAGAGTAAAAGTAAAAGTAATA
AGTGTGATAGGAAACAAAATTAGTTTGAGTATGAAAGATGTTGATTAAATAACTGGTTTA
GATAAGTTTGAACAAAAAATACGATATGAGGAATCCTAATCTCTCAAGTATGACCCTCTT
GAGTAGAAAGAAAAGAAGGCATTTGGTGTGTTAGATAAAGATGATATTATCAAATCAAAT
TAAAATTCAAAGTTCGGTGCTCTAACAGGTATTCTACTTGAAGATAAAGAGGAAAAAAAT
AAAAAGAGAATCAGAGAAAGTTCTTAAGAAAAGTGGGAACGTAAGTAAGCAGAATACTAT
TCCAGTAAACATTTGGGTATTGATAAAGGCGAAATAGATTTAGATGAAGGTTGTTCAGAA
GATGAAGATGTTGAAGTTGAAATTCGTGAGAACGAAACTCCCTTCTTAAAAGATACGACA
ACAAAGGCAGGAGTAAACTTATCTCCTATTAGAGTTACTAAAAACTAGAATGGCTCTTTG
AGTAGACAAGCACTTAATGCAGTTTAACAAGCAAAAGATAGAAGAGAAATTCGTATTTAG
CAAAACAATGCTTTGGTAGATAGTATTAACAAATAAGAACTCTAAAAAATGAATTTAGAT
CCTACTGCAGAATCTATTTTCCTTTTAAGTAATTTAAAGAAGTTGGGAGATGCTTAAACA
TCGGAAATTCCAGAATTTAAAAAAGAAGCAATGTTTAAGGCTGCTCTCAACAACTCTAAC
AAACCAAAATAAACTATGACAATCAAGGAGTAAAAAGAATCTCTTCCTATCTATTAATAT
AAGGAATAACTTATCAAAGCTTGCATTAATAATTAAATTCTTATTGTTATTGGTGAAACC
GGTTCAGGAAAAACAACTTAAATGACATAGTATCTCTTAGAAGCAGGCTTTTGTAAGAGT
GGTAAGAAAATTGGGTGTACCTAACCTCGTCGTGTTGCAGCTATGAGTGTTGCTAAGCGT
GTTTCTGAAGAAATGGGTGTAGTACTTGGTGAAGAAGTAGGTTATTCAATACGTTTTGAA
GATTGTACATCTGCTTCTACAGTAATTAAATATATGACTGATGGTATGCTTCTTCGTGAG
GCCTTGCTTGACACAGAACTAAGCAACTACTCAGTTATTATGCTCGATGAAGCACATGAA
AGATAGCTAAATACAGATGTTCTTTTTGGTTTACTTAAGAAAGTAGCTAAGAAAAGAAAA
GATTTTCATTTGATTATTACTTCCGCTACCCTTGATGCTGCAAAATTCTCTAATTATTTC
TTTGATTGCTAAGTTTTCCGTGTACCAGGTCGTACCTTCAAAGTCGATGTCCTCTACTCT
GTAGAACCTGAATAGGATTATGTTGAAGCTTCTTTAATTGTAATCATGCAAATTCACTTG
CATGAACCTCCTGGCGATATTCTCCTTTTCTTAACAGGTCAAGAAGAAATTGATAATGCA
TGCTAAATATTATTCTAGCGTATGAAGAACTTAGGTCCAGATGCACCTGAACTTATTATA
TTACCTCTTTATGCTGGTTTGCCTAATGAACTATAGAATAGAATTTTCCTTCCTACTCCT
GAGGGAAAACGTAAATGTATTATATCAACTAATATTGCAGAAGCATCTCTTACCATCGAT
GGTATTTACTATGTCGTAGATCCAGGATTTGCAAAAATTAAAGTTTACAATCCAAAACTT
GGTATGGATTCCTTGATTGTTGCACCAATTTCATAGGCTTCAGCGAAATAACGTTAGGGT
CGTGCAGGTCGTACAGGTCCTGGTAAATGTTTCCGTCTTTATACTGAAGATGCTTTCAAA
AATGAAATGCTCCCAACAAGTATACCTGAAATTCAGCGTACAAACTTAGCAAACACGGTT
TTACTTTTAAAGGCAATGGGTATTAATGATTTAATCAACTTCGATTTTATGGATCCTCCT
CCTATTCAAACTTTGATTTCTGCTTTAGAACATCTTTACACTTTAGGTTGTTTGGATGAT
GAAGGTCTCCTTACACGTCTCGGTTTGAAAATGGCCGAATTTCCTTTAGAACCACCTCTC
TCTAAAATGCTTATAACAAGTGTTGATCTTGGATGTTCAGATGAAATAGCTACTATTATT
GCTATGTTGTCAGTTTAAAATGTATTTTTCTGTCCAAAAGATAAAAAATAACAAGCTGAC
CAGCGTCGTGCTAAATTTCATCATTAAGATGGAGACCACTTAACTCTTTTGACTGTATAC
GAAGCTTGGAAATCAAACAATTTTTCAAATATTTGGTGTCATGAGAATTTCATAGATTCT
AGAACAATAAAAAGAGCACAAGATATTCGTAAACAGTTGATAGGTATCATGGACCGCTAT
CATTTACCTGTTTAATCGTGTGGTAAAAATTATGCCAAAATCCGTAAGGCTATATGTGCA
GGCTTCTTTAATCATGCAGCAAAAAAAGATCGTAACGAAGGATACAAAACTATCATAGAT
AATCATACTGTTAACATACATCCTACATCTGCACTTTTTTAGAAGCAGCCGGATTGGGTA
GTTTATCACGAATTAGTTTTGACAACTAAAGAATATATGAGAAATATTTCCACAATAGAA
CCAAAGTGGCTTGTTGAAGTTGCACCGAATTTCTTTTAAAACGTAAACCCTCATGTATTA
TCAAAAGCTAAAAAGGCTGAAAAGCTTGAATCACTCTCAACTAAAAGTGGTGATAACGAA
GCTTGGCGTCTGTCTAAAAGAAGAGGAAATGGTTGA


>TTHERM_00444310(protein)
MASNLQYVLLSQQVMQQLKTQLGIQDKDLVDYFIDQAFESDTEQQFAENIKDDAELSDQF
ISSLYKLIKSKQSLIKPKVDLQAQNKQLEDKKNKFSAGDPQKIDIEIEKEDIKQKEKVKR
DENYENEDSDEEQNELKRQELEKRKQYAKIFPALAQRDEIDLDQPQPEQKVDKNSSKFDP
KPTNIDARQEKEKETSNKEISRKKSSKHSRSRSKSHKKEKSKRRSRSRSQGKSKKKYSRS
RSKEKKNRSYSKEKKSRRSRSKSHEKKKKRDSPDAKKDHRKKYQRDSNSPLREKKGRENS
SRSRSQEKQTRQQFKRQEVEKDSILDGVVSKISEFGCFVTLENVGGRKEGLVHISQLSSK
RVGNIQEVARIGQRVKVKVISVIGNKISLSMKDVDQITGLDKFEQKIRYEESQSLKYDPL
EQKEKKAFGVLDKDDIIKSNQNSKFGALTGILLEDKEEKNKKRIRESSQEKWERKQAEYY
SSKHLGIDKGEIDLDEGCSEDEDVEVEIRENETPFLKDTTTKAGVNLSPIRVTKNQNGSL
SRQALNAVQQAKDRREIRIQQNNALVDSINKQELQKMNLDPTAESIFLLSNLKKLGDAQT
SEIPEFKKEAMFKAALNNSNKPKQTMTIKEQKESLPIYQYKEQLIKACINNQILIVIGET
GSGKTTQMTQYLLEAGFCKSGKKIGCTQPRRVAAMSVAKRVSEEMGVVLGEEVGYSIRFE
DCTSASTVIKYMTDGMLLREALLDTELSNYSVIMLDEAHERQLNTDVLFGLLKKVAKKRK
DFHLIITSATLDAAKFSNYFFDCQVFRVPGRTFKVDVLYSVEPEQDYVEASLIVIMQIHL
HEPPGDILLFLTGQEEIDNACQILFQRMKNLGPDAPELIILPLYAGLPNELQNRIFLPTP
EGKRKCIISTNIAEASLTIDGIYYVVDPGFAKIKVYNPKLGMDSLIVAPISQASAKQRQG
RAGRTGPGKCFRLYTEDAFKNEMLPTSIPEIQRTNLANTVLLLKAMGINDLINFDFMDPP
PIQTLISALEHLYTLGCLDDEGLLTRLGLKMAEFPLEPPLSKMLITSVDLGCSDEIATII
AMLSVQNVFFCPKDKKQQADQRRAKFHHQDGDHLTLLTVYEAWKSNNFSNIWCHENFIDS
RTIKRAQDIRKQLIGIMDRYHLPVQSCGKNYAKIRKAICAGFFNHAAKKDRNEGYKTIID
NHTVNIHPTSALFQKQPDWVVYHELVLTTKEYMRNISTIEPKWLVEVAPNFFQNVNPHVL
SKAKKAEKLESLSTKSGDNEAWRLSKRRGNG