Identifiers and Description

Gene Model Identifier

TTHERM_00444570

Standard Name

KHD3 (KH domain-containing protein 3)

Aliases

PreTt03825 | 51.m00191 | 3704.m00047

Description

KHD3 zinc knuckle protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10900.1 9.997093137033517e-262
Description: zinc knuckle family protein (668 aa)
Oxytricha Contig8621.0.g10 2.0000236365077126e-43
Description: KH domain
DictyBase DDB_G0293554 3.001129784945559e-41
Description: sf1 on chromosome: 6 position 3035802 to 3037515
SGD YLR116W 7.002785992501305e-33
Description: MSL5 Component of the commitment complex, which defines the first step in the splicing pathway; essential protein that interacts with Mud2p and Prp40p, forming a bridge between the intron ends; also involved in nuclear retention of pre-mRNA
WormBase WBGene00013808 3.998693556225637e-29
Description: locus:sfa-1 status:Confirmed UniProt:G5EF97 protein_id:CAB55136.2
Stentor Coeruleus SteCoe_3903 1.0530617357553812e-20
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444570(coding)
ATGTCTAATCCAATTCCAATAGCACTAGGCGTCTTTGAAGGATAGGAAAATCTAGATTAA
TAAGAGTAAAATAAAGATAAAAAAGATAGTCAAAGCGAAAATAATTCTTAAAAAATTAAA
GATTCAGAGGAAGTCATTATCAGTGAAGAGATTGACAATGGTGGTTATTTTGATAGAACA
AATTACGATGTTTATAATGTTAAAAGGGATGGCTACTTCTTTGCAGATGAAGTTAAAGTT
GATGGTGAAACTATTTTCACAATTCCAATAGAGAAGCAATTAGAAGATAATGAAGACTTG
CCAAAAAGAAAATCAAGATGGGGTGATAGACCTTAAAGGAGAAGAAAAGTTTAAGTAAAC
CATATATTTAATCCTTTGCAAGGACTAACTACTGGAAATGGTCTTTTGTCTATTACAGCA
GATGGTTATAAGTATGGCTAATAATATCCTGATAAAAAAGAAGAAGAAGAGGAGAAATTT
TCAAGATGGGGACCTGAATACGAAAAGACTTTCCATCCTCCTCCTTTGAACTACATTCCT
CAAAATATTAACGATGATGATTTAGAATACATAATCAGACTCTACAGGTTAGACGAAATA
TAAAATAAAATGATTAATAAAATTCAAACACTCGAAGATGATTCTGATTGTAGGTCTCCA
TCTCCTGACCCAATTTACAATGAATAAGGTAAAAGAATCAACACTAGAGATTACAGAGAA
TAAGAGTCTTTGTAGAAAGAAAAATATAATTTAATAGAAGAAGCAATGAGAATTAATCCT
GCTTTTATTCCTCCTCACGATTTCAAGGTTTAGAAAAAGCAAAAGAAAATTTATCTACCA
GAACAAAATGCAGAATTATTAAAACAAAAAGTAATTGGACCTAAGGGTTAAACTCACAAA
AGACTTGAGTAGGAAAGTGGCTGTAAAATTAGTATTAAGGGTAAAGGCTCAGGAAACGGA
ATGAAGAGAGTAGAAAATGATTTCAATGATAAGCTTCATATTCTTTTGTAAGGTGATACT
GATGAATAATTAGAAAAGGGTGCTACACTCGTTGATGAAATTCTTAGAGGAGAAGATAAA
TCTAATGAAAATACTTTTAAGGGAGGAGATCTTGTTATCATTCATGATGTCCTCAATAGA
GATTTTTGTTCAAAATGCCATTAAACTGGACATAGAGATTTTGAATGTTAATCAAAGACC
ACTTTTAATAAGGTTGATGTCAAGTGTATTTATTGTGGAGATAAAGGCCATATTTCAGCT
GATTGTAAATTTAAGAGAGAGAGATAGCAGTAAAATAGAGAGAGAGGAAATGATGTAGAT
ATCAATACTTAATTCGAGTAATTTATAAATTAAGTTGAAGGAGATGATAGATTACTTAGT
AGCTTTGGTGGCAGAGCGAACTAAAATAAGTCAATTACAAATACTAGCTTTATTACTGAT
GCTATAGAAATAGATCCTAATCTTCTTATGATCAAAGCAGATGATAACCTTTACAAAAAT
ACAAAAGAACCAACATTTTCGAATGGACCTTCAGCTCCTTCTTATTCTAACGACTTCCAA
TAAGGAGGTTACAACAACAATTTCAATAAAAATAGAGACTATAGAAGGGAAACAAATGAT
TAATTTAATAAAAATAATGATAGATTTAATAGTTAGAGTGGCAGTAATAGATAATAAGAC
TCTTCTAGAGCACCTATACCTCCTCCTATCCTACCTCCAGGAAGTGATCATTTAGCCCCA
CCCTCATTTATGAATTAAAATACAATGGGTCATTTTGGTGGTTTACCCATGCCTGGTATA
GCTAATCCTTCAGCTATGCCACCACCTGGTATGCCAGGCAGTTTATATCCTCCTCCAATG
CCTCCAGGTGGTTATCCTATGTTTAATCCATATGCCCCACCAGGTTTTGGAGGTCTTCCT
CCTCCTATGTTCCCCCCACACCCTCACTTAAATGTTCCATACGGATATAATCCCTTATAT
CCATAAGGATATAATTAATAAAATTAACCACACAAATGA


>TTHERM_00444570(gene)
ATGTCTAATCCAATTCCAATAGCACTAGGCGTCTTTGAAGGATAGGAAAATCTAGATTAA
TAAGAGTAAAATAAAGATAAAAAAGATAGTCAAAGCGAAAATAATTCTTAAAAAATTAAA
GATTCAGAGGAAGTCATTATCAGTGAAGAGATTGACAGTACGAGATAGAATTTCTTAATT
TAAAATAGATTGATCGCAATCACCTTCATCTTTAAATCCAAAATAAAGTTATAAAAGCAT
GCAGGCTAATTATAAAAAATAATTAGGCAGCAAGATTGAAGAGATTTATTTTAAGTTTTG
TATTTTAAAATAAAATAAGATTACTGGTTTAAAAAACTTAAAGATTCATTCAATAATTTG
AGGATTAAATATTTATTTGCAGATTTCAATCTAGCTTAAATTGCATTAAAAAAATAGTTT
ATCACAAAGAAAATTCTCTAATTTGAACTATTGATAGATGAATGATTGAAAGATTATAAA
CATATTTATATAGTTAAAACAATTAATATTAAATTTTTTATTTTTAAATTTATATATAGA
TGGTGGTTATTTTGATAGAACAAATTACGATGTTTATAATGTTAAAAGGGATGGCTACTT
CTTTGCAGATGAAGTTAAAGTTGATGGTGAAACTATTTTCACAATTCCAATAGAGAAGCA
ATTAGAAGATAATGAAGACTTGCCAAAAAGAAAATCAAGATGGGGTGATAGACCTTAAAG
GAGAAGAAAAGTTTAAGTAAACCATATATTTAATCCTTTGCAAGGACTAACTACTGGAAA
TGGTCTTTTGTCTATTACAGCAGATGGTTATAAGTATGGCTAATAATATCCTGATAAAAA
AGAAGAAGAAGAGGAGAAATTTTCAAGGTATTTTTTTTAAGACCATTCTTCTTAGTATTT
TAATTTTAATATTGTAAAAAGATGGGGACCTGAATACGAAAAGACTTTCCATCCTCCTCC
TTTGAACTACATTCCTCAAAATATTAACGATGATGATTTAGAATACATAATCAGACTCTA
CAGGTTAGACGAAATATAAAATAAAATGATTAATAAAATTCAAACACTCGAAGATGATTC
TGATTGTAGGTCTCCATCTCCTGACCCAATTTACAATGAATAAGGTAAAAGAATCAACAC
TAGAGATTACAGAGAATAAGAGTCTTTGTAGAAAGAAAAATATAATTTAATAGAAGAAGC
AATGAGAATTAATCCTGCTTTTATTCCTCCTCACGATTTCAAGGTACTAAACTTTTCAAT
AAAATAAAAAAGATATTTAAGTTTATTTATTTAAAAATTTTAAGAAAAAAGCTTACAATA
AATGCACTAAAATTAGAAAATATTATTTAAATTTTAAAACAAATTATTAAAATAATTATA
AATTCAAAAATTGTTTTACAATGTTAGATTAAAATTGAAGAAAAAGTGAAAGCAATTAAA
AAGATTAAAAATCTATTTATAATTTAAATAGCGAGATATTTATTACATAGACAAAACTCA
AAATATTATTTTAATAATTTAATAATATATTTCTAACAAAATTTAATAATACAATGAGCT
TCAATAATTTAGAATCTATCTATTATTTAATAAAGAAAGAATTGTCAAAAACAAACATAT
TTATTACTAAAAATTTACATTTTAACTTTCTTAATTAATATAGGTTTAGAAAAAGCAAAA
GAAAATTTATCTACCAGAACAAAATGCAGAATTATTAAAACAAAAAGTAATTGGACCTAA
GGGTTAAACTCACAAAAGACTTGAGTAGGAAAGTGGCTGTAAAATTAGTATTAAGGGTAA
AGGCTCAGGAAACGGAATGAAGAGAGTAGAAAATGATTTCAATGATAAGCTTCATATTCT
TTTGTAAGGTGATACTGATGAATAATTAGAAAAGGGTGCTACACTCGTTGATGAAATTCT
TAGAGGAGAAGATAAATCTAATGAAAATACTTTTAAGGGAGGAGATCTTGTTATCATTCA
TGATGTCCTCAATAGAGATTTTTGTTCAAAATGCCATTAAACTGGACATAGAGATTTTGA
ATGTTAATCAAAGTAAAAATGTTGCAATTTATAAACATTAATTTAATGATTTCTTTTTTT
AAAAAAAATAGGACCACTTTTAATAAGGTTGATGTCAAGTGTATTTATTGTGGAGATAAA
GGCCATATTTCAGCTGATTGTAAATTTAAGAGAGGTAAATAATAAAAATAAAATAATATG
ATAAATATGAAAAAATCTTTTATCATAAATATAGAGAGATAGCAGTAAAATAGAGAGAGA
GGAAATGATGTAGATATCAATACTTAATTCGAGTAATTTATAAATTAAGTTGAAGGAGAT
GATAGATTACTTAGTAGCTTTGGTGGCAGAGCGAACTAAAATAAGTCAATTACAAATACT
AGCTTTATTACTGATGCTATAGAAATAGATCCTAATCTTCTTATGATCAAAGCAGATGAT
AACCTTTACAAAAATACAAAAGAACCAACATTTTCGAATGGACCTTCAGCTCCTTCTTAT
TCTAACGACTTCCAATAAGGAGGTTACAACAACAATTTCAATAAAAATAGAGACTATAGA
AGGGAAACAAATGATTAATTTAATAAAAATAATGATAGATTTAATAGTTAGAGTGGCAGT
AATAGATAATAAGACTCTTCTAGAGCACCTATACCTCCTCCTATCCTACCTCCAGGAAGT
GATCATTTAGGTAGCTAAAATTTCATTTCATGTATTATTAAAAATTAACTATTTTCTAAA
TAATTAGCCCCACCCTCATTTATGAATTAAAATACAATGGGTCATTTTGGTGGTTTACCC
ATGCCTGGTATAGCTAATCCTTCAGCTATGCCACCACCTGGTATGCCAGGCAGTTTATAT
CCTCCTCCAATGCCTCCAGGTGGTTATCCTATGTTTAATCCATATGCCCCACCAGGTTTT
GGAGGTCTTCCTCCTCCTATGTTCCCCCCACACCCTCACTTAAATGTTCCATACGGATAT
AATCCCTTATATCCATAAGGATATAATTAATAAAATTAACCACACAAATGA


>TTHERM_00444570(protein)
MSNPIPIALGVFEGQENLDQQEQNKDKKDSQSENNSQKIKDSEEVIISEEIDNGGYFDRT
NYDVYNVKRDGYFFADEVKVDGETIFTIPIEKQLEDNEDLPKRKSRWGDRPQRRRKVQVN
HIFNPLQGLTTGNGLLSITADGYKYGQQYPDKKEEEEEKFSRWGPEYEKTFHPPPLNYIP
QNINDDDLEYIIRLYRLDEIQNKMINKIQTLEDDSDCRSPSPDPIYNEQGKRINTRDYRE
QESLQKEKYNLIEEAMRINPAFIPPHDFKVQKKQKKIYLPEQNAELLKQKVIGPKGQTHK
RLEQESGCKISIKGKGSGNGMKRVENDFNDKLHILLQGDTDEQLEKGATLVDEILRGEDK
SNENTFKGGDLVIIHDVLNRDFCSKCHQTGHRDFECQSKTTFNKVDVKCIYCGDKGHISA
DCKFKRERQQQNRERGNDVDINTQFEQFINQVEGDDRLLSSFGGRANQNKSITNTSFITD
AIEIDPNLLMIKADDNLYKNTKEPTFSNGPSAPSYSNDFQQGGYNNNFNKNRDYRRETND
QFNKNNDRFNSQSGSNRQQDSSRAPIPPPILPPGSDHLAPPSFMNQNTMGHFGGLPMPGI
ANPSAMPPPGMPGSLYPPPMPPGGYPMFNPYAPPGFGGLPPPMFPPHPHLNVPYGYNPLY
PQGYNQQNQPHK