Identifiers and Description

Gene Model Identifier

TTHERM_00444670

Standard Name

HSP90 (Heat Shock Protein 90)

Aliases

PreTt03835 | 51.m00201 | 3704.m00057 | HSC82

Description

HSC82 heat shock protein HSP90; Hsp90 protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00183 ) Hsp90 protein
  • ( PF02518 ) ATPase, histidine kinase-, DNA gyrase
  • ( TIGR00042 ) non-canonical purine NTP pyrophosphatase, rdgB/HAM1

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_18146 0
Description: None
WormBase WBGene00011480 9.997093137033517e-262
Description: locus:enpl-1 status:Confirmed UniProt:Q22235 protein_id:CAA92973.1
Tetrahymena borealis EI9_10887.1 9.997093137033517e-262
Description: hsp90-like protein (794 aa)
DictyBase DDB_G0267400 9.997093137033517e-262
Description: hspD on chromosome: 1 position 1280990 to 1283391
Oxytricha Contig7273.0.g45 9.997093137033517e-262
Description: Hsp90 protein
SGD YMR186W 9.997093137033517e-262
Description: HSC82 Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels than HSP82 and induced 2-3 fold by heat shock

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444670(coding)
ATGAGAGTTTAATTAAAAAGCTTCATATTGTTGTTGATGATTGTTCTTCAACAACATGTT
ACTGTAATTAGGGCTGCCGAATAAGGTGTAGAAGAATTTGAATTCTAGACTGAAGTTGGT
CGTCTTATGGATATTATCATTAACTCACTTTATACCTAAAAAGAAATTTTCTTAAGAGAA
TTAATTTCTAACTCTTCTGATGCTTTGGATAAACTCCGTTTCTTGTCTGTTAAGGACCCT
AAGCTCACTGAAGATTTCAAGAACCTTGAAATCTACGTTGACTTCGATGCTGAAAAGAAA
ACCATTTCCATTACCGATACTGGTATTGGTATGACTAAGCAAGATCTTATCCAAAACTTG
GGTACTATCGCTAAGTCTGGTACCACTAACTTCATCGAAGCCATTAAAGGTGGTAATGTC
AACATCATTGGTCAATTTGGTGTCGGTTTCTACAGTTCTTTCTTGGTTGCCTAAAAGGTT
TAAGTTAGCTCTAAGCACCCTGAAGATGAACAATGGGTTTGGGAAAGTAGCGCTGCTAAC
TCATTCCATGTTTTTAAGGAGACTGAATAACTCTTATAAAGAGGTACTCGTGTTACCCTT
TTCTTAAAGCAAGATGCTTAAGAATTCTTAGATGAAAAGAAGTTAGGTGAACTTATTAAG
AGACACTCTGAATTCATTAACTTCCCTATTAACTTGAGACACTTCAAGGAAGTAGAAAAA
GAAGTTGTTGATGAAGAAGCTGAAGCTAAGAGAGCTGAAGAAAAGGCTGCTAAGACTGAT
GAAGAAATCAACGAAGAAACCGATGAAAAGCCTATCATGAAGAAAATCAAGGAAAAGGTC
CCTGAATGGAAGGTTATGAATGACAACAAGGCTATTTGGACTCGTCCTAAGGAAGAAATT
TCTGATGAAGATTACGTCTAATTCTACAAGAGTTTCTCTAAGGATTACGAAGATCCCCTT
AACTGGATTCATTTCAAGGGTGAAGGTGAAGTCGAATTCACTTCTCTTCTTTATTGTCCT
AAGAAGGCTCCTCATGATTTATTCGAAAACTACTATGGTAAGTCTGCTGCCTTAAAGCTT
TACGTCAGAAGAGTACTTATCAATGAAGAATTCGAAGAACTCATGCCCAGATACTTAAAT
TTCATTAGAGGTGTTGTAGATTCTGATGATCTTCCCCTTAATGTCAACAGAGAAAGTATC
CAATAAGTTAAAATGCTTAAGGTTATGAGCAGAAAGCTTGTTAGAAAAGCTCTTGATATG
ATCAAAAAGATGGCTGATGAAGAAGGTGGTGATGATTCTGAAGATGAAGATGACTCTGAA
GAATCCCATGAAGAAGAAGTCAAGCAAAAGGAACCTAAGGAAGGTGAATAACACTCTGAA
GATGATGATGATGAAAAGGGAGAAGATAAAGAAAAGCTCACCCAAGAAAGAAGAGATCGT
TACAAAGCTTTCTGGAAGGAGTTCGGTAAAAATATCAAGCTTGGTATAATTGAAGATTCC
TCCAACAGAAACAAGTTAGCTAAGTTAACAAGATGGTACTCTTCTCATAACTCTACTGAA
TTAACTTCATTTGACTAATACATCAGCAGAGCTAAGGAAAACTAAGACAGCATCTACTTC
TTAGCTGGTGAAACTAAGGAAATTATCTTGAACCACCCTACCATTCAAAAGTTACTCAAG
AAAGGTTATGAAGTCCTTTTACTTGATGATCCTATTGATGAATTCACATTCTAAAACTTG
AATGAATATGAAAAGAAGAAACTCGTTAATGTTGGTAAGGGTAACTTCAAATTCCCTGAA
GACAACGAAACTGAAAGAAAGAGAAATAAAGCTGTCAAGAAGGCTTTCGAACCTTTGACT
TCATGGTGGAAGAAATTATTAACCAACGATTTAGACGAAGTCAGAATCTCTCAAAGATTA
CACGATGATCCTTGCGTCATTGTTTCCAGCGAACATGGTTACTCTGCCTAAATGGAAAGA
ATTTCTAAGGCTTAAGCTTATGCTAACCAAGATAGATCTAACCCTGCTGCCAACCAAAAG
AAGATCCTTGAAATTAATCCTAACCATCCAGCTATTAAGGAACTCCTTGAAAGAGTTAAG
GAAGATCCTGATTCATAAACTGAAGAAATCGCAAACGTCCTTTACGAAGGAGCTTTGGTT
AACTCTGGTTACTCTCTCAAGGACCCTGCTGGTTTTGCCAAGAAATTCTACAGACTTTTA
AATAACGCTCTTGGTATTCCTAAGGACGCTCCTATCGAAGAATATGAAGTCGATATTGAA
GATGATGAAGAAGAAGCTAAATCTGATAGCCAAACTCAATCTGATGAAAATGTAGACATC
GATGATAATGGTAACGATTAACAAGAAGTTAAAGACGATTTGTGA


>TTHERM_00444670(gene)
ATGAGAGTTTAATTAAAAAGCTTCATATTGTTGTTGATGATTGTTCTTCAACAACATGTT
ACTGTAATTAGGGCTGCCGAATAAGGTGTAGAAGAATTTGAATTCTAGACTGAAGTTGGT
CGTCTTATGGATATTATCATTAACTCACTTTATACCTAAAAAGAAATTTTCTTAAGAGAA
TTAATTTCTAACTCTTCTGATGCTTTGGATAAACTCCGTTTCTTGTCTGTTAAGGACCCT
AAGCTCACTGAAGATTTCAAGAACCTTGAAATCTACGTTGACTTCGATGCTGAAAAGAAA
ACCATTTCCATTACCGATACTGGTATTGGTATGACTAAGCAAGATCTTATCCAAAACTTG
GGTACTATCGCTAAGTCTGGTACCACTAACTTCATCGAAGCCATTAAAGGTAAATTCTTA
TTTAAATTTAATTCAATATTCAAAGAATGTAATCCAGCTATCATGAAACTATTATCAGCT
TCTATTTTTAATAAAATAAACCAAATGATAAGCACCTACTTTACATTATTCTTTAACACA
TCCTTTGTCTATGGTTTAAATATGATTGGATCAATTATAATCAAAATTTTTAAAAATTCA
CATAAAAAAAAAATGTCTGATTAAAAAAAAGAGTTTATTGTAACAATGACATTATGAGTT
TATTGTAAAAGATAATTTTTATAGGACAATGATTGCTTTAGCTTAGCATTTTATTTTTTA
TTTTTTCTGATCATTTTTTTTAAAAAAAGGTGGTAATGTCAACATCATTGGTCAATTTGG
TGTCGGTTTCTACAGTTCTTTCTTGGTTGCCTAAAAGGTTTAAGTTAGCTCTAAGCACCC
TGAAGATGAACAATGGGTTTGGGAAAGTAGCGCTGCTAACTCATTCCATGTTTTTAAGGA
GACTGAATAACTCTTATAAAGAGGTACTCGTGTTACCCTTTTCTTAAAGCAAGATGCTTA
AGAATTCTTAGATGAAAAGAAGTTAGGTGAACTTATTAAGAGACACTCTGAATTCATTAA
CTTCCCTATTAACTTGAGACACTTCAAGGAAGTAGAAAAAGAAGTTGTTGATGAAGAAGC
TGAAGCTAAGAGAGCTGAAGAAAAGGCTGCTAAGACTGATGAAGAAATCAACGAAGAAAC
CGATGAAAAGCCTATCATGAAGAAAATCAAGGAAAAGGTCCCTGAATGGAAGGTTATGAA
TGACAACAAGGCTATTTGGACTCGTCCTAAGGAAGAAATTTCTGATGAAGATTACGTCTA
ATTCTACAAGAGTTTCTCTAAGGATTACGAAGATCCCCTTAACTGGATTCATTTCAAGGG
TGAAGGTGAAGTCGAATTCACTTCTCTTCTTTATTGTCCTAAGAAGGCTCCTCATGATTT
ATTCGAAAACTACTATGGTAAGTCTGCTGCCTTAAAGCTTTACGTCAGAAGAGTACTTAT
CAATGAAGAATTCGAAGAACTCATGCCCAGATACTTAAATTTCATTAGAGGTGTTGTAGA
TTCTGATGATCTTCCCCTTAATGTCAACAGAGAAAGTATCCAATAAGTTAAAATGCTTAA
GGTTATGAGCAGAAAGCTTGTTAGAAAAGCTCTTGATATGATCAAAAAGATGGCTGATGA
AGAAGGTGGTGATGATTCTGAAGATGAAGATGACTCTGAAGAATCCCATGAAGAAGAAGT
CAAGCAAAAGGAACCTAAGGAAGGTGAATAACACTCTGAAGATGATGATGATGAAAAGGG
AGAAGATAAAGAAAAGCTCACCCAAGAAAGAAGAGATCGTTACAAAGCTTTCTGGAAGGA
GTTCGGTAAAAATATCAAGCTTGGTATAATTGAAGATTCCTCCAACAGAAACAAGTTAGC
TAAGTTAACAAGGTAAACTAACAAAAACTATTTATTTATTTATTAATCAATTTCAATCAA
GTTTTTATTTTTTGAATATCAAAACATAAAAACAAATTAGTAAATAAATTATAGCAAGCT
TTTTATTCATTAGCGAATTATCAGAAAAAAGTCAATTAGTTCATCATAAATTAATCAAAA
AAAGATATTTTTTCATAGCAATTTAAATAAAGTTTGATTTAAATAATTAAAAAATAAAAA
AATAACAACAAAAAAATTTACTTGGGAAAAAAAATTAACTGTGGAAAAAAATTTAGAAAA
ATTTTTTTTTTAAAAATGCTTATTTTATTTTTATTAAAAATTTAATTAATTTAAATTTAA
TAATTTAATTTATAATAAATAAATAGATGGTACTCTTCTCATAACTCTACTGAATTAACT
TCATTTGACTAATACATCAGCAGAGCTAAGGAAAACTAAGACAGCATCTACTTCTTAGCT
GGTGAAACTAAGGAAATTATCTTGAACCACCCTACCATTCAAAAGTTACTCAAGAAAGGT
TATGAAGTCCTTTTACTTGATGATCCTATTGATGAATTCACATTCTAAAACTTGAATGAA
TATGAAAAGAAGAAACTCGTTAATGTTGGTAAGGGTAACTTCAAATTCCCTGAAGACAAC
GAAACTGAAAGAAAGAGAAATAAAGCTGTCAAGAAGGCTTTCGAACCTTTGACTTCATGG
TGGAAGAAATTATTAACCAACGATTTAGACGAAGTCAGAATCTCTCAAAGATTACACGAT
GATCCTTGCGTCATTGTTTCCAGCGAACATGGTTACTCTGCCTAAATGGAAAGAATTTCT
AAGGCTTAAGCTTATGCTAACCAAGATAGATCTAACCCTGCTGCCAACCAAAAGAAGATC
CTTGAAATTAATCCTAACCATCCAGCTATTAAGGAACTCCTTGAAAGAGTTAAGGAAGAT
CCTGATTCATAAACTGAAGAAATCGCAAACGTCCTTTACGAAGGAGCTTTGGTTAACTCT
GGTTACTCTCTCAAGGACCCTGCTGGTTTTGCCAAGAAATTCTACAGACTTTTAAATAAC
GCTCTTGGTATTCCTAAGGACGCTCCTATCGAAGAATATGAAGTCGATATTGAAGATGAT
GAAGAAGGTAAATAAATAAATATAATTTAAATATTTTTAAAACTAATTATGATTTTTCTT
ATTAAATAGAAGCTAAATCTGATAGCCAAACTCAATCTGATGAAAATGTAGACATCGATG
ATAATGGTAACGATTAACAAGAAGTTAAAGACGATTTGTGA


>TTHERM_00444670(protein)
MRVQLKSFILLLMIVLQQHVTVIRAAEQGVEEFEFQTEVGRLMDIIINSLYTQKEIFLRE
LISNSSDALDKLRFLSVKDPKLTEDFKNLEIYVDFDAEKKTISITDTGIGMTKQDLIQNL
GTIAKSGTTNFIEAIKGGNVNIIGQFGVGFYSSFLVAQKVQVSSKHPEDEQWVWESSAAN
SFHVFKETEQLLQRGTRVTLFLKQDAQEFLDEKKLGELIKRHSEFINFPINLRHFKEVEK
EVVDEEAEAKRAEEKAAKTDEEINEETDEKPIMKKIKEKVPEWKVMNDNKAIWTRPKEEI
SDEDYVQFYKSFSKDYEDPLNWIHFKGEGEVEFTSLLYCPKKAPHDLFENYYGKSAALKL
YVRRVLINEEFEELMPRYLNFIRGVVDSDDLPLNVNRESIQQVKMLKVMSRKLVRKALDM
IKKMADEEGGDDSEDEDDSEESHEEEVKQKEPKEGEQHSEDDDDEKGEDKEKLTQERRDR
YKAFWKEFGKNIKLGIIEDSSNRNKLAKLTRWYSSHNSTELTSFDQYISRAKENQDSIYF
LAGETKEIILNHPTIQKLLKKGYEVLLLDDPIDEFTFQNLNEYEKKKLVNVGKGNFKFPE
DNETERKRNKAVKKAFEPLTSWWKKLLTNDLDEVRISQRLHDDPCVIVSSEHGYSAQMER
ISKAQAYANQDRSNPAANQKKILEINPNHPAIKELLERVKEDPDSQTEEIANVLYEGALV
NSGYSLKDPAGFAKKFYRLLNNALGIPKDAPIEEYEVDIEDDEEEAKSDSQTQSDENVDI
DDNGNDQQEVKDDL