Identifiers and Description

Gene Model Identifier

TTHERM_00449029

Standard Name

DLC82 (Dynein Light Chain 82)

Aliases

3811.m00956

Description

DLC82 cytoplasmic dynein light chain 2; Dynein light chain 8B

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14979.1 1.9990871925214856e-61
Description: hypothetical protein (93 aa)
Oxytricha Contig20780.0.g106 2.0008113830639685e-30
Description: Dynein light chain type 1
WormBase WBGene00001005 6.997498932278805e-30
Description: locus:dlc-1 Dynein light chain 1, cytoplasmic status:Confirmed UniProt:Q22799 protein_id:CCD63216.1
SGD YDR424C 2.000620012690291e-23
Description: DYN2 Cytoplasmic light chain dynein, microtubule motor protein; proposed to be involved in the assembly of the nuclear pore complex
DictyBase DDB_G0274815 1.0002869940498747e-21
Description: dlcB on chromosome: 2 position 3974977 to 3975525
Stentor Coeruleus SteCoe_36801 0.000000000000012664165549094176
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00449029(coding)
ATGAGTCATTTGGATAAAGTTTAACCAGTTATTAAGAACTCTGATATGAGTGTTGAAATG
TAGAAGGAAGTTGAAGAAGTAGCTAAAAAAGCTATCGATTACTGTAACACTGATAAAGAA
ATAGCCACATTTATTAAGGATGATTTTAGATCTCGTTATCATGGAACTTGGCATTGTATT
GTTGGCAGAAACTTTGGAAGTTTCGTCACTTTTGAGCGTAGTTACTATATTTATCTTTAT
GTTGGATAGCTCGCTATTTTGCTTTTCAAAACCGGTTGA


>TTHERM_00449029(gene)
ATGAGTCATTTGGATAAAGTTTAACCAGTTATTAAGAACTCTGATATGAGTGTTGAAATG
TAGAAGGAAGTTGAAGAAGTAGCTAAAAAAGCTATCGATTACTGTAACACTGATAAAGAA
ATAGCCACATTTATTAAGGATGATTTTAGATCTCGTTATCATGGAACTTGGCATTGTATT
GTTGGCAGAAACTTTGGAAGTTTCGTCACTTTTGAGCGTAGTTACTATATTTATCTTTAT
GTTGGATAGCTCGCTATTTTGCTTTTCAAAACCGGTTGA


>TTHERM_00449029(protein)
MSHLDKVQPVIKNSDMSVEMQKEVEEVAKKAIDYCNTDKEIATFIKDDFRSRYHGTWHCI
VGRNFGSFVTFERSYYIYLYVGQLAILLFKTG