Identifiers and Description

Gene Model Identifier

TTHERM_00449090

Standard Name

SNF8 (Sucrose NonFermenting )

Aliases

PreTt15427 | 52.m00205 | 3811.m00962

Description

EAP30/Vps36 family protein; Component of the ESCRT-II complex

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14986.1 4.999555668078159e-151
Description: hypothetical protein (246 aa)
WormBase WBGene00016167 7.996210139153865e-29
Description: locus:vps-22 status:Confirmed UniProt:Q18258 protein_id:CCD65742.1
DictyBase DDB_G0283203 2.9993110246221282e-28
Description: vps22 on chromosome: 4 position 415279 to 416235
SGD YPL002C 7.000924640675686e-24
Description: SNF8 Component of the ESCRT-II complex, which is involved in ubiquitin-dependent sorting of proteins into the endosome; appears to be functionally related to SNF7; involved in glucose derepression
Oxytricha Contig10454.0.g12 6.996829646809514e-23
Description: EAP30/Vps36 family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00449090(coding)
ATGTATGGCGGTAAATAAGCAATGATGAAGTAGCTAGAATAGCAATAAGCTAGATAGCAG
ATGGGATAGTAGTTAATGCAGCAGAAAATTACAAGAATGAAGGACATTTATAATGTTTTT
TAAGAAAATATGCAAAAATACGCTGCATAATATGCTAATGAAATCAATAAAGATCCAAAC
TTTAGAGACAACTTTAATTAGCTCTGCTAAAATTTAGGCATAGATCCTATGATATCATAA
AAAACCTTATTTTCAAACCTTGGATTTGGAGATTTCTACAACGAATTAGCAATGAAGATT
TTGGATATTACAGCCCGTAAAAGAAATGAGAATGGTGGAATGATGAAATTGATTGACATC
ATTAATGAATTCGAAAAAAGATATAAAACAAAGATATCCAAGAAAGACATTTAAGAAGCC
TTAAAAACAATAACTTGTCTTGGTGGTTGTCAGTTAGTTAACAATGAGTATGTAAGCACT
TCTAACTTATCTATGTCAGGGGACTTTAATAGTGTAATTGAAATTGCTGAAAAGTATGGT
CATGTCAGTGAGTAGCTTATGAAAGAATAAAAAGGATGGAATAAAGACAAATTTAAATTA
GTAATAGATTAGCTGAGAGGAGAAGGCATGGTTTGGGTAGATAAAAAAACTCAGTCTGGT
CTACCTAATTATTATTTCCCCTCCATGCTTAATAGCTTTGTTGATAATTTATAAGAATTC
AGTAAATATATTAAATGA


>TTHERM_00449090(gene)
ATGTATGGCGGTAAATAAGCAATGATGAAGTAGCTAGAATAGCAAGTAATGAGCATAAAA
TATTTTTGTTTCTTTAGAACATTACTTTTAAATTTAGGTTTGACAATTATAATATAATTT
GTTTCTAATAGTAAGCTAGATAGCAGATGGGATAGTAGTTAATGCAGCAGAAAATTACAA
GAGTAAAAAATATTTATGATTAGTCTTGCAGTCATTAAATAAACTAACTTATTTTATGGA
TTATTAATTTAGATGAAGGACATTTATAATGTTTTTTAAGAAAATATGCAAAAATACGCT
GCATAATATGCTAATGAAATCAATAAAGATCCAAACTTTAGAGACAACTTTAATTAGCTC
TGCTAAAATTTAGGCATAGATCCTATGATATGTAGCTTAATATTATTTTCTTAAACTGTT
TTTAGCATTATATTCTTACTTTAACAAACAAATAGCATAAAAAACCTTATTTTCAAACCT
TGGATTTGGAGATTTCTACAACGAATTAGCAGTAAATTTGATATTGAAAAGTAATAGATA
AGCAACAAGTATTATAATTAAATTAATAAAATAGATGAAGATTTTGGATATTACAGCCCG
TAAAAGAAATGAGAATGGTGGAATGATGAAATTGATTGACATCATTAATGAATTCGAAAA
AAGATATAAAACAAAGATATCCAAGTAAATATAGAAAGCAATCAATCAATATATTTTAAT
AAACTGCAAAATACTATTTTTAGTAATTTAAAAAAATTAATCCTTTTTTATTTTAAAGGA
AAGACATTTAAGAAGCCTTAAAAACAATAACTTGTCTTGGTGGTTGTCAGTTAGTTAACA
ATGAGTATGTAAGCACTTCTAACTTATCTATGTCAGGGGACTTTAATAGTGTAATTGAAA
TTGCTGAAAAGGTAATCAATATTTTTATTTGTTAAAATGATTTAATCAATAATTCATTTT
ATTCCATAGTATGGTCATGTCAGTGAGTAGCTTATGAAAGAATAAAAAGGATGGAATAAA
GACAAATTTAAATTAGTAATAGATTAGCTGAGAGGAGAAGGCATGGTTTGGGTAGATAAA
AAAACTCAGTCTGGTCTACCTAATTATTATTTCCCCTCCATGCTTAATAGCTTTGTTGAT
AATTTATAAGAATTCAGTAAATATATTAAATGA


>TTHERM_00449090(protein)
MYGGKQAMMKQLEQQQARQQMGQQLMQQKITRMKDIYNVFQENMQKYAAQYANEINKDPN
FRDNFNQLCQNLGIDPMISQKTLFSNLGFGDFYNELAMKILDITARKRNENGGMMKLIDI
INEFEKRYKTKISKKDIQEALKTITCLGGCQLVNNEYVSTSNLSMSGDFNSVIEIAEKYG
HVSEQLMKEQKGWNKDKFKLVIDQLRGEGMVWVDKKTQSGLPNYYFPSMLNSFVDNLQEF
SKYIK