Identifiers and Description

Gene Model Identifier

TTHERM_00449570

Standard Name

RRP9 (ribosomal RNA processing protein 9)

Aliases

PreTt15470 | 52.m00248 | 3811.m01001

Description

RRP9 U3 small nucleolar RNA-interacting protein; U3 small nucleolar RNA-interacting protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15008.1 9.997093137033517e-262
Description: hypothetical protein (492 aa)
Oxytricha Contig11865.0.g86 7.003229617538552e-69
Description: WD domain, G-beta repeat
DictyBase DDB_G0293412 7.00308173940364e-57
Description: DDB_G0293412 on chromosome: 6 position 2844115 to 2846244
WormBase WBGene00020171 5.0020095550341075e-51
Description: status:Partially_confirmed UniProt:A9D0C6 protein_id:CCD73583.1
SGD YPR137W 2.000470901975128e-28
Description: RRP9 Protein involved in pre-rRNA processing, associated with U3 snRNP; component of small ribosomal subunit (SSU) processosome; ortholog of the human U3-55k protein
Stentor Coeruleus SteCoe_13738 0.0000000000006914400106940203
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00449570(coding)
ATGAACACTAAGAAGCAAAAAGGCAACCTTTTAGGAAAAAGAAAGAACGCCAAATAAGTC
TTATAAAAAAATATTGAAAAAAAGCCATAAAAGAAGAAGGTTGTATAAAATAAAGATCTT
GATGAAGAAATTCTTTCAGATGAAATAGATTCTGTTTCAGGTATGAGCAATGAAGGTGGA
ATCGAAGATCGTTTAATTGAAATAGATGATGAAACTGAGGATAAAAAGAGAATTAGATTG
GCATAGTAAATTTTATAGAAAGCAAAGCTAGATTCATAAAAAGGCAAGAGTTAAAAGTTT
ATTGATAAAATATAAAATACTGGAAATAATGATGTTAGTGATGATGAGTCTTTTGATGAT
GGTGAAGACCACCACAAAAGTGAAGGAGATTCCTTTTAAGGTGTTATTTATGCTGAATCA
ACTCATACTGATGCAATCACAAAGGCTCTTTAAAATGAAATTTTGAAAAAAAGATAGCTC
TAATATACTTTATATGCTGATAAAGTTCAAAAGTATTGGAATAAAATTGGATAAACCTTT
TAATAAAATACTTTAAAAGGTCATACAAGATGTATCACTTCTCTTGAATTCTGTCCAAAT
GGATAATACTTATATTCTGCATCTAAGGATGCCTCCATCATTAGATGGGATTTAACTTAA
ACAGAAAAAAGTAAATAAAAGGAATTCTTAGTTAGAGAAAAAACTACCGATGCTCATAAA
GATGAGATTTTATCAATGAGTATTAATCATCTTGGAAGATATTTAGTTACAGCTAGTAAA
GATAAATCAATCAAGTTATGGGATTTAAAGAAAATGGGATTAATTTAAAATTTCAATGGT
CACAGATAACCTATAAATGCTATTAAATTCGGTATAAACTCAAACCAATTCTGTACTGCA
TCTTCAGACAGATAATTCAAAATGTGGGATGCTTCTGATAAAATATTTATTGATACATTC
TTTGGACATAAGGCTGACCCTACATATATTGACTCTATGAGTGCTAATAATTTCATTAGT
TGTGGCTTTGACAGATAGGTCATCATTTGGAAAACTGAACATTAATCTTAATTGATATAT
GGAGGTCATGACTACTCCATTGATGTTGTAAAAGCAGTAGATGCAGAACATTTTATTACA
GGATCTCAAGATGGATCTATTGCTCTTTGGTCTATTAAGAAGAAAAAACCTATATTTATT
ATGCATAAAGCCCATGGAGGAAGTTGGATTACTGCTTTGGGACATCTTTATAACACTGAT
TTATTTTTTTCTGGCTCTCATGATTAACAAATTAATGCTTATAAAATTGATTTACAATAA
AAGAACTTTTAAAAAATATTTTCCATTCCTTGTAATGGCGTAATAAATGACATACAAATA
TCAATAGATTGTTCTTATCTTGCATGTAAAAAAGTTAATTTGATAGATTATAATTTATTA
AATGAATATTTGTAAAAAAAAGTTAGCGAGTGTGATGAACATAGACTTGGTAGATGGATT
ACAGATAAGAAAGCAAAAAATTAGATTAAGTATTTCAAAATAATGTGA


>TTHERM_00449570(gene)
ATGAACACTAAGAAGCAAAAAGGCAACCTTTTAGGAAAAAGAAAGAACGCCAAATAAGTC
TTATAAAAAAATATTGAAAAAAAGCCAGTAACGAATACTTAAAAATCAATTTTTTTAATT
AGCTACTTTGGTTCATTAATCGATAAATGGATTCATTGGTTTTAGCCATCATAAATTATC
TAAAATATTTTTAAAGAAATGAACTCTAAATTTAATCAAAATTAAAATATTCTATTTTAT
TAATCAAATAGTAAAAGAAGAAGGTTGTATAAAATAAAGATCTTGATGAAGAAATTCTTT
CAGATGAAATAGATTCTGTTTCAGGTATGAGCAATGAAGGTGGAATCGAAGATCGTTTAA
TTGAAATAGATGATGGTAAATAAACTATTAATTGTTTGTTTTCTATATAATAATAAAGAA
GCTTTGCAGGATAAAAGTAGTTAACAGGTGAAGGAAATTTTATGTCAGCTAATAAGTTAA
TTTTTTTGAAATGAGCATGCGAATAAGAGCAAATATTTTAGATATTGTTTCATCATTAAT
TGCTAATATTTACTTAATAAGGGATTTTAAGAATATAAAAAAAGAATTACTTTTACTGCA
AAGAAACTTAAACTTTAGCTTATGATAGGTTTACATTAAAAATTATTTTAAAATTATTCA
AATAGAAACTGAGGATAAAAAGAGAATTAGATTGGCATAGTAAATTTTATAGAAAGCAAA
GCTAGATTCATAAAAAGGCAAGAGTTAAAAGTTTATTGATAAAATATAAAATACTGGAAA
TAATGATGTTAGTGATGATGAGTCTTTTGATGATGGTGAAGACCACCACAAAAGTGAAGG
AGATTCCTTTTAAGGTGTTATTTATGCTGAATCAACTCATACTGATGCAATCACAAAGGC
TCTTTAAAATGAAATTTTGAAAAAAAGATAGCTCTAATATACTTTATATGCTGATAAAGT
AATTATTTAATTAAATAAATAAATAGATAATTAGATAGATTTTTAGCTAGATATTTTCAA
GCAAGTAGAATTAAATTAAATTTATAAATTACTATTTTATAAAAAGGTTCAAAAGTATTG
GAATAAAATTGGATAAACCTTTTAATAAAATACTTTAAAAGGTCATACAAGATGTATCAC
TTCTCTTGAATTCTGTCCAAATGGATAATACTTATATTCTGCATCTAAGGATGCCTCCAT
CATTAGATGGGATTTAACTTAAACAGAAAAAAGTAAATAAAAGGAATTCTTAGTTAGAGA
AAAAACTACCGATGCTCATAAAGATGAGGTAAAATATACACTTTGATATTTAGATAAAAT
AAACACGCTAGCAAATTAAAGATAAATCTTAAATGTAAAAATGTAAAAAAATGATATATT
AGATTGAATGAGTTAGCTTTGAACTTATTTGTAAAAAAAAATTTTATGAAAAAGAAAAAA
AAGTTTTTTAATATTTCAGAATAACTAATTTGATTTTATAATAATTTTAAATTTTTATTA
AATAAGATTTTATCAATGAGTATTAATCATCTTGGAAGATATTTAGTTACAGCTAGTAAA
GATAAATCAATCAAGTTATGGGATTTAAAGAAAATGGGATTAATTTAAAATTTCAATGGT
CACAGATAACCTATAAATGCTATTAAATTCGGTATAAACTCAAACCAATTCTGTACTGCA
TCTTCAGACAGATAATTCAAAATGTGGGATGCTTCTGATAAAATATTTATTGATACATTG
TAAATATAATAATTATAAATGGCCAGTTTTTTAATATATAAATTTGACTTATTCAATAGC
TTTGGACATAAGGCTGACCCTACATATATTGACTCTATGAGTGCTAATAATTTCATTAGT
TGTGGCTTTGACAGATAGGTCATCATTTGGAAAGTAAAAATATTTGGATAATATAATTTT
ATTTAATAAATATAATAAACAAATAGACTGAACATTAATCTTAATTGATATATGGAGGTC
ATGACTACTCCATTGATGTTGTAAAAGCAGTAGATGCAGAACATTTTATTACAGGATCTC
AAGATGGATCTATTGCTCTTTGGTCTATTAAGAAGAAAAAACCTATATTTATTATGCATA
AAGCCCATGGAGGAAGTTGGATTACTGCTTTGGTAAATATTTAAAGCAATAAAAAAATAA
TATTAAATTTATTTTTATTTTTTAATTATTTAGGGACATCTTTATAACACTGATTTATTT
TTTTCTGGCTCTCATGATTAACAAATTAATGCTTATAAAATTGATTTACAATAAAAGAAC
TTTTAAAAAATATTTTCCATTCCTTGTGTAAATAAAAATTTACTTATTTCTTTAAAATTA
ATGAAAAAATATTATTAAAAATAGAATGGCGTAATAAATGACATACAAATATCAATAGAT
TGTTCTTATCTTGCATGTAAAAAAGTTAATTTGATAGATTATAATTTATTAAATGAATAT
TTGTAAAAAAAAGTTAGCGAGTGTGATGAACATAGACTTGGTAGATGGATTACAGATAAG
AAAGCAAAAAATTAGATTAAGTATTTCAAAATAATGTGA


>TTHERM_00449570(protein)
MNTKKQKGNLLGKRKNAKQVLQKNIEKKPQKKKVVQNKDLDEEILSDEIDSVSGMSNEGG
IEDRLIEIDDETEDKKRIRLAQQILQKAKLDSQKGKSQKFIDKIQNTGNNDVSDDESFDD
GEDHHKSEGDSFQGVIYAESTHTDAITKALQNEILKKRQLQYTLYADKVQKYWNKIGQTF
QQNTLKGHTRCITSLEFCPNGQYLYSASKDASIIRWDLTQTEKSKQKEFLVREKTTDAHK
DEILSMSINHLGRYLVTASKDKSIKLWDLKKMGLIQNFNGHRQPINAIKFGINSNQFCTA
SSDRQFKMWDASDKIFIDTFFGHKADPTYIDSMSANNFISCGFDRQVIIWKTEHQSQLIY
GGHDYSIDVVKAVDAEHFITGSQDGSIALWSIKKKKPIFIMHKAHGGSWITALGHLYNTD
LFFSGSHDQQINAYKIDLQQKNFQKIFSIPCNGVINDIQISIDCSYLACKKVNLIDYNLL
NEYLQKKVSECDEHRLGRWITDKKAKNQIKYFKIM