Identifiers and Description

Gene Model Identifier

TTHERM_00454080

Standard Name

RPS22 (Ribosomal Protein of the Small subunit 22)

Aliases

PreTt15525 | 52.m00303 | 3811.m01051

Description

RPS22 predicted protein; Homolog of yeast RPS22- bacterial RPS8;

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15038.1 3.9984352235938583e-87
Description: ribosomal protein S8 containing protein (131 aa)
Oxytricha Contig12805.0.g106 8.998258374026963e-65
Description: Ribosomal protein S8
DictyBase DDB_G0276457 5.002115178225629e-63
Description: rps15a on chromosome: 2 position 6809160 to 6809552
SGD YLR367W 2.0002571866765887e-62
Description: RPS22B Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Ap and has similarity to E. coli S8 and rat S15a ribosomal proteins
WormBase WBGene00004491 4.000904604388404e-59
Description: locus:rps-22 status:Confirmed UniProt:O17218 protein_id:CCD62154.1
Stentor Coeruleus SteCoe_35703 5.380186160021138e-32
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00454080(coding)
ATGGTCAAGGTTAACATTTTGGCTGAATGCCTTAAGGATTTAGTTAATGCCGAAAAGATG
GGTAAGAAGCAAGTTCTCTTAAGACCCGTTTCCAAGGTCGTCCTCAAGTTCTTAAGAATT
ATGTAAAAGAACGGTTACATTGGTGAATTCGAAGTTATCGATGACCACAGATCCAAGAAG
GTCGTTGTTGAACTTATTGGCAGAATTAACAAATGCGGTGTTATTTCTCCCAGATATGAC
GTTCCTCTTGCTGACTTCGAAAAGTGGACTAACAATATCCTTCCCTCCAGACAATTCGGT
AATGTTGTTCTCACCACCACTTACGGTATTCTTACTCACGAAGAATGCAGAAAGAGACAC
ACTGGTGGCAAGATCCTCGGTTTCTTCTATTGA


>TTHERM_00454080(gene)
ATGGTCAAGGTTAACATTTTGGCTGAATGCCTTAAGGATTTAGTTAATGCCGAAAAGATG
GGTAAGAAGCAAGTTCTCTTAAGACCCGTTTCCAAGGTCGTCCTCAAGTTCTTAAGAATT
ATGTAAAAGAACGGTTACATTGGTGAATTCGAAGTTATCGATGACCACAGATCCAAGAAG
GTCGTTGTTGAACTTATTGGCAGAATTAACAAATGCGGTGTTATTTCTCCCAGATATGAC
GTTCCTCTTGCTGACTTCGAAAAGTGGACTAACAATATCCTTCCCTCCAGACAATTCGGT
AATGTTGTTCTCACCACCACTTACGGTATTCTTACTCACGAAGAATGCAGAAAGAGACAC
ACTGGTGGCAAGATCCTCGGTTTCTTCTATTGA


>TTHERM_00454080(protein)
MVKVNILAECLKDLVNAEKMGKKQVLLRPVSKVVLKFLRIMQKNGYIGEFEVIDDHRSKK
VVVELIGRINKCGVISPRYDVPLADFEKWTNNILPSRQFGNVVLTTTYGILTHEECRKRH
TGGKILGFFY