Identifiers and Description

Gene Model Identifier

TTHERM_00455500

Standard Name

JMJ2 (JMJC domain-encoding 2)

Aliases

PreTt20279 | 53.m00181 | 3712.m00042

Description

JMJ2 JmjC domain protein; JmjC domain containing protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

Tetrahymena Stock Center

  • ( SD01739 ) Micronucleus: PAR1 gene partially replaced by neo4-KanR2 cassette. Macronucleus: JMJ2 gene partially replaced by neo4-KanR2 cassette.
  • ( SD01774 ) Micronucleus: JMJ2 gene partially replaced by neo4-KanR2 cassette.
  • ( SD01775 ) Micronucleus: JMJ2 gene partially replaced by neo4-KanR2 cassette.

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13742.1 9.997093137033517e-262
Description: jmjC domain-containing protein (678 aa)
Oxytricha Contig16165.0.1.g65 7.002855521298715e-86
Description: JmjC domain, hydroxylase
DictyBase DDB_G0268778 3.999543040313994e-55
Description: rbbB on chromosome: 1 position 2082803 to 2086499
WormBase WBGene00004319 6.001502944943701e-53
Description: locus:rbr-2 Lysine-specific demethylase rbr-2 status:Partially_confirmed UniProt:Q23541 protein_id:CAA93426.2
SGD YJR119C 2.9995979253168707e-35
Description: JHD2 JmjC domain family histone demethylase specific for H3-K4 (histone H3 Lys4); removes methyl groups specifically added by Set1p methyltransferase; protein levels regulated by Not4p (E3 ubiquitin ligase) polyubiquitin-mediated degradation
Stentor Coeruleus SteCoe_29255 8.533047625744066e-17
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22427430: Chung PH, Yao MC (2012) Tetrahymena thermophila JMJD3 homolog regulates H3K27 methylation and nuclear differentiation. Eukaryotic cell 11(5):601-14

Sequences

>TTHERM_00455500(coding)
ATGGGTAGAGGTGATAGGTGCAGTGTTAGAACTAAAAAATGCCCAAAAACGGCTGAAAAA
TCTAAACAAAAGGCACATACAAAATAAATATCAAAAAAAATTTAAAACTCTCACGGGAAT
ACGTGCACCATAAATGTAAACACCCATGCTATACTAAGTAACTCAACAGCTATAAAGGTA
AAGGCTAGAAAGGTATCTTAAAAACGCATACCTTCCAATAAAATGATTTCCACTGAAGAT
TAGAAAGTAGAAAGAAATGTTAAAAATCCATCGCTTATACTTATTGAAGATGAATCCCAT
TCCACGAATTTTGAATCATACGCAAGTCCGAGAATGAATTGTGTAGTAAGCTAGTCACCA
GCTAATAGCCCTTCTTAAGACTATAATAATTAAGACTATTGCTCTCATAACTAGCATTTG
CACCCGAACTAGAACTCAATATTCTACTCAATGAGATGCGGTGGCAATGTATAGTAGTAG
TCTAGAAATGGTAGCAAGACTTCTATTGAGAACATTAAATCACATCAATCAATCAATTTT
TAGGGTGAAGATCTATTAAGTCTTAATCCACTTTAAAACCCTAAAATGCGCTTACCTTCC
GAGTATTCTTCTTTTATCGAAGTACCTACAGTATTTCCTACTGAAGAGGAATTCAAAGAC
CCCTATAAATTATTTGCTATGTTACATCAATAGGGTTATCACAAACATGGAATAGTTAAA
ATTATCCCTCCTAAGTCTTGGAAACCCTAATATAATTTTGATAAAATTACAGAAAAAGTT
ACAACAAGAACTCAAATCTTGGCTGAGCTCTCGCAAGCCTAGCCTTTCTCTTAAAATAAT
GACTAATACACTTACAAAGAATTTAAAAAGATGGCAGATGATTTTAAAAAAACGTATAAA
TTTTAGACCAAAACAAACTTTTAGAACGAATATCGTTAAATTGAATATGAGTTTTGGGAG
CATGTAGAGCACCCCGAACTATTCAAGGACGAGCTAGAAGTTGAATATGCTGCCGACTTA
CCCTCAAAAAAATATGGATCAGCATTCTCTGTTATGGATAACATGCACAACTCTACCTTC
AATTTGAATAACATCAACTCTATAAAAAATTCTCTATTTTAGCACTTTTCTAAAGACCAC
AGTGGCATAAGTGGGATCAGTAATCCTTGGGTATATTTAGGAATGATGTTTGCTTCTTTT
TGCTGGCACGTAGAAGATTTATATATGTGCGCCTTAAATTATTTACACATAGGAGAAGCT
AAAACTTGGTATGGCATTCCTCCAGAATACAAATACAAGTTTGAAGAAGTCTATAAGAAA
ACATATCCTCAAATTTTCAAAAAGAAGCCTGATGTTTTATTTCACATTAATTTGATGCTA
TCTCCTGCTGTTGCTTTAGAAAATGGGATACCAGTTTACAGAACTGAATAAAAACCAGGC
GAGTTTATATTTACATTCCCTAAAACATACCATGCTGGATTCTCTCATGGATTTAATTGT
GGAGAGGCTGTGAATGTAATTACTTTTGATTGGTTCTAAAATTATTAAGAGGCTGTATAG
TACTATTAAACAATAAAACACCCGACTAAAAATTATTTTAAGAGTGCCTCTTTTGCTGTT
GAATGGTTAATTTCTTAAGTTATTATGAACATGGAATAATCAAAATTCGATCTTTCAACT
TTAGTTAAAATAAAAGAGGAATGGAGCAAAATTGTTTAAGCAGAGTAGTAAAAAAGAAAA
AAAGTTTTAGCCAAATATGGAGAAGAAAATGTAAAAATATGCGAGTTTTCAAACAAAAAG
GAAAGATATGACAGACATATCTGCTGGCTTTGTGGATATTATAGTTTTTACAGCTACTTA
TTTTGTAATAGTTGTATTAAAAAGAGTTGCACCAGCCATGATACTCCTTGTAAGTGCAAT
AAAACTCCTTAACTTTTCATTCGCTTTACAGATGAGGACTTTGCAGAGTAGGAAGAAATA
ATAAATTAAAAAATGAAAGAATGCTCCTAATGA


>TTHERM_00455500(gene)
ATGGGTAGAGGTGATAGGTGCAGTGTTAGAACTAAAAAATGCCCAAAAACGGCTGAAAAA
TCTAAACAAAAGGCACATACAAAATAAATATCAAAAAAAATTTAAAACTCTCACGGGAAT
ACGTGCACCATAAATGTAAACACCCATGCTATACTAAGTAACTCAACAGCTATAAAGGTA
AAGGCTAGAAAGGTATCTTAAAAACGCATACCTTCCAATAAAATGATTTCCACTGAAGAT
TAGAAAGTAGAAAGAAATGTTAAAAATCCATCGCTTATACTTATTGAAGATGAATCCCAT
TCCACGAATTTTGAATCATACGCAAGTCCGAGAATGAATTGTGTAGTAAGCTAGTCACCA
GCTAATAGCCCTTCTTAAGACTATAATAATTAAGACTATTGCTCTCATAACTAGCATTTG
CACCCGAACTAGAACTCAATATTCTACTCAATGAGATGCGGTGGCAATGTATAGTAGTAG
TCTAGAAATGGTAGCAAGACTTCTATTGAGAACATTAAATCACATCAATCAATCAATTTT
TAGGGTGAAGATCTATTAAGTCTTAATCCACTTTAAAACCCTAAAATGCGCTTACCTTCC
GAGTATTCTTCTTTTATCGAAGTACCTACAGTATTTCCTACTGAAGAGGAATTCAAAGAC
CCCTATAAATTATTTGCTATGTTACATCAATAGGGTTATCACAAACATGGAATAGTTAAA
ATTATCCCTCCTAAGTCTTGGAAACCCTAATATAATTTTGATAAAATTACAGAAAAAGTT
ACAACAAGAACTCAAATCTTGGCTGAGCTCTCGCAAGCCTAGGTAAATATTTAGAATATT
TAAATAAATATAAAATGATGGAGAATTTTTAGTATGTTTCTTAAAGTAGGAGTGATATTA
AAGGGAGTATAAAAATCTTAAAATAAATCTATTTTTACTTTTTTTGACATTAAAAAATAG
CTTTGATTAAGCTAATACAAATATAATTTCTGATTCAGCTGTCTCTTAATATTGATTATA
AAAATTCAGCTTCTAAATTTATAGACATAGCAGAATGAATCTAAATGAGTGGATTTTATT
GCACCAAATTTATTTTACTCTAATCCTACTTTTATAGCTCTTATTAAAAACAAACAAATT
AATTTCTCCTTCTTTACTTAAAAAATTAATCAGCGGTTCAATAATTTTACAAAATAATTT
TGTATGAACTTGATAAAATATTAATATTTTATTTTTAAAATATATTTATTAATAGCCTTT
CTCTTAAAATAATGACTAATACACTTACAAAGAATTTAAAAAGATGGCAGATGATTTTAA
AAAAACGTATAAATTTTAGACCAAAACAAACTTTTAGAACGAATATCGTTAAATTGAATA
TGAGTTTTGGGAGCATGTAGAGCACCCCGAACTATTCAAGGACGAGCTAGAAGTTGAATA
TGCTGCCGACTTACCCTCAAAAAAATATGGATCAGCATTCTCTGTTATGGATAACATGCA
CAACTCTACCTTCAATTTGAATAACATCAACTCTATAAAAAATTCTCTATTTTAGCACTT
TTCTAAAGACCACAGTGGCATAAGTGGGATCAGTAATCCTTGGGTATATTTAGGAATGAT
GTTTGCTTCTTTTTGCTGGCACGTAGAAGATTTATATATGTGCGCCTTAAATTATTTACA
CATAGGAGAAGCTAAAACTTGGTAATTATTTTATTATTTTATCCTCAATTTAATGAATAA
ATTTTTTTTTCTATTTCCTTCATTAAAACTTTTAGCTTATTTTTCTATTTCGAATTATTT
TTTGTGTGATAATTTAAAAAAATCACAATCTAAAAAGATTAAATGGCTTCCTTCATTATT
TTAAATTACATTTATTATTTTAAGGAAAGCCATTCATTCTACTAATCCTAATTAATTCAA
TCATATTTTTACATATCAATCTATTAATTATGCATTGGCTAGATAGATCGCATTCAAGTT
TTTTTAAATACAAGCAAATTCCCCCCTTTATTCATATGTATTCATTTACAATACAAAGAC
TATTAAATAAATGTATTAAATCAAGATTCTTTACTATCTGCACATTTTGTAAATATTCAT
ATTATGGAAATCTAACAGATGGAGGTTTTATTAATTTTTATCTAAGGAATTATTAAATTA
CGTCATATCACATTAGTATTTTTAGATAAAATTTAAAAAATTCCAACTTAAATTTTGCAC
TTTTTTAATACTTTTTTCTTCCAAAATTGAAAAAAATTAATGCATTTGATAAAGATTAAA
GTTATATTTAAATAATCATTAAGAAATTTAAGTCGTTTAAATTAACTGCAAGTCTCATTT
CAAATTTATTTTTTTTAAAAGGTATGGCATTCCTCCAGAATACAAATACAAGTTTGAAGA
AGTCTATAAGAAAACATATCCTCAAATTTTCAAAAAGAAGCCTGATGTTTTATTTCACAT
TAATTTGATGCTATCTCCTGCTGTTGCTTTAGAAAATGGGATACCAGTTTACAGAACTGA
ATAAAAACCAGGCGAGTTTATATTTACATTCCCTAAAACATACCATGCTGGATTCTCTCA
TGGATTTAATTGTGGAGAGGCTGTGAATGTAATTACTTTTGATTGGTTCTAAAATTATTA
AGAGGCTGTATAGTACTATTAAACAATAAAACACCCGACTAAAAATTATTTTAAGAGTGC
CTCTTTTGCTGTTGAATGGTTAATTTCTTAAGTTATTATGAACATGGAATAATCAAAATT
CGATCTTTCAACTTTAGTTAAAGTAATTTTCTTGAAAATTAGCAAGCATTAATTTAATTT
TTTTAAACATTTTAAATAAAATTTATATTTGTTATTAAACTTAGATAAAAGAGGAATGGA
GCAAAATTGTTTAAGCAGAGTAGTAAAAAAGAAAAAAAGTTTTAGCCAAATATGGAGAAG
AAAATGTAAAAATATGCGAGTTTTCAAACAAAAAGGAAAGATATGACAGACATATCTGCT
GGCTTTGTGGATATTATAGTTTTTACAGCTACTTATTTTGTAATAGTTGTATTAAAAAGA
GTTGCACCAGCCATGATACTCCTTGTAAGTGCAATAAAACTCCTTAACTTTTCATTCGCT
TTACAGATGAGGTAATTATAATTTATAAATAAATTAGCTTTCTTTACTTTAGAAACATTT
AAAAAATAAATGAATAAAATATAATATATTTTTTTACAAAAAAAGGACTTTGCAGAGTAG
GAAGAAATAATAAATTAAAAAATGAAAGAATGCTCCTAATGA


>TTHERM_00455500(protein)
MGRGDRCSVRTKKCPKTAEKSKQKAHTKQISKKIQNSHGNTCTINVNTHAILSNSTAIKV
KARKVSQKRIPSNKMISTEDQKVERNVKNPSLILIEDESHSTNFESYASPRMNCVVSQSP
ANSPSQDYNNQDYCSHNQHLHPNQNSIFYSMRCGGNVQQQSRNGSKTSIENIKSHQSINF
QGEDLLSLNPLQNPKMRLPSEYSSFIEVPTVFPTEEEFKDPYKLFAMLHQQGYHKHGIVK
IIPPKSWKPQYNFDKITEKVTTRTQILAELSQAQPFSQNNDQYTYKEFKKMADDFKKTYK
FQTKTNFQNEYRQIEYEFWEHVEHPELFKDELEVEYAADLPSKKYGSAFSVMDNMHNSTF
NLNNINSIKNSLFQHFSKDHSGISGISNPWVYLGMMFASFCWHVEDLYMCALNYLHIGEA
KTWYGIPPEYKYKFEEVYKKTYPQIFKKKPDVLFHINLMLSPAVALENGIPVYRTEQKPG
EFIFTFPKTYHAGFSHGFNCGEAVNVITFDWFQNYQEAVQYYQTIKHPTKNYFKSASFAV
EWLISQVIMNMEQSKFDLSTLVKIKEEWSKIVQAEQQKRKKVLAKYGEENVKICEFSNKK
ERYDRHICWLCGYYSFYSYLFCNSCIKKSCTSHDTPCKCNKTPQLFIRFTDEDFAEQEEI
INQKMKECSQ