Identifiers and Description

Gene Model Identifier

TTHERM_00455610

Standard Name

NUP88 (NUcleoPorin 88)

Aliases

PreTt20290 | 53.m00192 | 3712.m00053

Description

hypothetical protein; Nucleoporin protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_36368 0
Description: None
Tetrahymena borealis EI9_13753.1 9.997093137033517e-262
Description: hypothetical protein (937 aa)
DictyBase DDB_G0279039 0.000019995566179747357
Description: DDB_G0279039 on chromosome: 3 position 1541078 to 1544303

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834

Sequences

>TTHERM_00455610(coding)
ATGGAGAATAACCTTTTAGAATCAAGACTAAATAAAATCTTGTCAGATAAAAAGTTTAGC
AAATTGAATAAAAGCATAGAGAAGCATCTCAATAAGGAAACAGGCATTTTTATTAAGGAC
TACTTTTTAGTTCTTGAATATGAATCACTTGATGAAAAGGTAATTCAGAGTAAAAAGAAG
GAGCTTTTAGAAAATTCAATGCACGATCATATAGAAAAAGATGACGATTCTGTTTAATAC
TTTGCACTATACTTATGGATTTTTAATTTGACTGCAGGCCAATTCTTAGAAAATAACGAA
AATAAATTAGCTACTAGAATACCTGTAAATTTACAAAGTTACAACATGTTCAATGCACAA
GATTAATAAATATAGTCTGCCAAAAACACAATCGAAAGCTTTGGTAACGTCTTTTGCATG
TCTAAGAAAATCGGAGAGTAATCTCTCTAAATAATAAATAGTAATATAGATGAATACTAA
ATAGCAATTTATTCTGAAAAATAAATTTTTGTTGGCCATATTGAAAACATTATAAATTCC
TATTTTATTAAGCAAAGCAAAGATGATCAAAATGCCTTTACAATGTACCGTGTATAATTA
TTTATATAAAAATACTCTCCAAGCATTTTAAGCATTAAATTCCACAAATTATCTCCTCAT
CATTTGGCTGTTCTTTTAGATGATTAGTACTTTTGCGTTTATAATCTGCAATCTAGTCTT
TCTTACTAGGAGGTGTAATTTAATCTTTAATAACTTCCACGCTTTGGTAGAAACGAAGAG
TATAATTATTAAGAAAAAGGATAAGTTTAGTTTGTTGATTTCGAATTTGGAGGCAACAGC
TTTTTCACTAGCTATTCGAAAACCAATTTCTAAATTCCTTCTGATTTCGATTTTCTGTCA
GTATATTTTCTTACTGAAGATGGTTAAATTTACTACCAATCTCCATTTTTAGTAAAAGAT
ATGAGAATTAACAGATAATTAATTGAAGAACTTAAGGATTATCTTGTTCAAGAATTAAAA
TTGGTGGAACAGCATGAATAAATATAAGAAAAATTATAGGTGTTAAAATCTTATTTAGAC
TTAGTAGAATAAATTGACAGCAGAGATTTGATAAGTGAATGCGAATAACCTACCAAATTA
TCTAAAATAGTTACTCAAACAGATAAGTCCAGTTCATTTGAAGTTCCTATTTTTAATAGC
ATCAGCATGCAAGACTTGCTGAATGATGATTTCTAAATACAATTAAGATATGTTCCTACA
GAATAAAATAACGAAGATGATTAAGAAAATTTAGAAAATAACAGTAACTTACAGTCTCAG
TTTAAATCAAGTGGCTTTGGAACAAAATCTAACATCTAAGTTTTTTCAAAATCGTTAATG
GACAGATTTACTAGAGATAATAAGAATCAAATTATGTATAGGAAATATAGTAAATTCCAC
AAAGTGGAAACAAAGGGTTAACTCCATGTCTTTATTTTAACAAAGCAAATCGGTAATAAA
ACTTACTCTACTGTATCTTCACGTTTTAGTCCTCTTCCAGTCATGCCTACTCATATTGTT
CAAGACTTTTACTAGTTTTGTCTTTTATCTGGTGAAAAAGCACATCTTGAATGCCCATTA
AGCTCTTTAATCAACTATACAGGAAATTAATCTAAAAAGAATATCTATGAATATAAATAA
AATTAATGTGCTAGACTCTGTTCTAAGGCAATTGAAACATCAACACTTGACAGTGTTTGC
TTCTAACTTATGAATAGAATATATTGTATTAACTTTAAGTGGATTTAGAATTTGATTTTA
ACAAACTTATCAGACCCTAAAGTATTTAATGATGAAGAATTGTCTAGAAGTGAAATTAGA
GTCTTAGTTGATTCTCAGCAAATCGATAGCTAGGATAAATTAGATGCATGTAAATTAACA
GATTTATCTTTTTATTGCTTATCTGAAAAAGACAGAATGCTTCTAGCAGTTATTCCTTCC
CACCACTCACAATAGTAATAGCCTTTTAGGTTAAAATGCTTAACTTTAGACTTCTTGTCA
AACTATATTTAAATTTAAAAGAGTGCTAAGCTTATATCTGAGACTTTACACAAGATGATT
AAAGAATAAGTAGAGCCTGAAAAAGCAAAAGAAAATAACCAATCAGGATAAAAACTAGCT
TAAAATGATGTGAAGCTTCAGGAAATTGCTGATTAAGATAATAAAGTAGATCTTGATAAC
TTTTAAAAGTAAGTAACAGCTTACATAAGCAAGCATGAAGAAGTTTTATAATAGAATATT
TAGTTAATACAAATTAAATATCAAGAGGTATTAAAGAAAAAAGAAGAGTTGAAAAATACA
AAGGAAAAAACAGAAAGCCAATTTTATGAAATCATAGAAAACAAATAAAAGAAGTTGTTA
GAAAGCAAAAAAAGAATTGAAGAAAAAAATAAGTCAATCAATTAAAAAATTTAAGAAATT
GCTTAAAAATTAAAAGACCCTAAAGCTTCAAATGAATTAGACAATGTTAAAGAAGCAAAT
ATCACATTTAATGAAAAATATAATGAGTAAATTAAGACATACTATAATAAACTTAAAGAA
ATCGAAGAATAATACTAAAAGTACTTCAAAACTAGAAGTGAGTTCTTCAATTCATTAGGT
GTTCAAAGCAATACAAACCTACAAATTGATGAAAACACTTTATAAAAAATTAATGAAACA
AGAAATAAGCTAAAATACCACATGAAAATCCTTGATAATTAGATCATTTAAACCAATCCT
CAAGATAATTGA


>TTHERM_00455610(gene)
ATGGAGAATAACCTTTTAGAATCAAGACTAAATAAAATCTTGTCAGATAAAAAGTTTAGC
AAATTGAATAAAAGCATAGAGAAGCATCTCAATAAGGAAACAGGCATTTTTATTAAGGAC
TACTTTTTAGTTCTTGAATATGAATCACTTGATGAAAAGGTAATTCAGAGTAAAAAGAAG
GAGCTTTTAGAAAATTCAATGCACGATCATATAGAAAAAGATGACGATTCTGTTTAATAC
TTTGCACTATACTTATGGATTTTTAATTTGACTGCAGGCCAATTCTTAGAAAATAACGAA
AATAAATTAGCTACTAGAATACCTGTAAATTTACAAAGTTACAACATGTTCAATGCACAA
GATTAATAAATATAGTCTGCCAAAAACACAATCGAAAGCTTTGGTAACGTCTTTTGCATG
TCTAAGAAAATCGGAGAGTAATCTCTCTAAATAATAAATAGTAATATAGATGAATACTAA
ATAGCAATTTATTCTGAAAAATAAATTTTTGTTGGCCATATTGAAAACATTATAAATTCC
TATTTTATTAAGCAAAGCAAAGATGATCAAAATGCCTTTACAATGTACCGTGTATAATTA
TTTATATAAAAATACTCTCCAAGCATTTTAAGCATTAAATTCCACAAATTATCTCCTCAT
CATTTGGCTGTTCTTTTAGATGATTAGTACTTTTGCGTTTATAATCTGCAATCTAGTCTT
TCTTACTAGGAGGTGTAATTTAATCTTTAATAACTTCCACGCTTTGGTAGAAACGAAGAG
TATAATTATTAAGAAAAAGGATAAGTTTAGTTTGTTGATTTCGAATTTGGAGGCAACAGC
TTTTTCACTAGCTATTCGAAAACCAATTTCTAAATTCCTTCTGATTTCGATTTTCTGTCA
GTATATTTTCTTACTGAAGATGGTTAAATTTACTACCAATCTCCATTTTTAGTAAAAGAT
ATGAGAATTAACAGATAATTAATTGAAGAACTTAAGGATTATCTTGTTCAAGAATTAAAA
TTGGTGGAACAGCATGAATAAATATAAGAAAAATTATAGGTGTAAGCAATTAAACTACTT
TCATTCTATAATATATAAGTTTTAAATATGTTTATTAGAGTTTTGAGTTTTAAAAAATAA
AAATATTTTATTTAATTAAAAGGTTAAAATCTTATTTAGACTTAGTAGAATAAATTGACA
GCAGAGATTTGATAAGTGAATGCGAATAACCTACCAAATTATCTAAAATAGTTACTCAAA
CAGATAAGTCCAGTTCATTTGAAGTTCCTATTTTTAATAGCATCAGCATGCAAGACTTGC
TGAATGATGATTTCTAAATACAATTAAGATATGTTCCTACAGAATAAAATAACGAAGATG
ATTAAGAAAATTTAGAAAATAACAGTAACTTACAGTCTCAGTTTAAATCAAGTGGCTTTG
GAACAAAATCTAACATCTAAGTTTTTTCAAAATCGTTAATGGACAGATTTACTAGAGATA
ATAAGAATCAAATTATGTATAGGAAATATAGTAAATTCCACAAAGTGGAAACAAAGGGTT
AACTCCATGTCTTTATTTTAACAAAGCAAATCGGTAATAAAACTTACTCTACTGTATCTT
CACGTTTTAGTCCTCTTCCAGTCATGCCTACTCATATTGTTCAAGACTTTTACTAGTTTT
GTCTTTTATCTGGTGAAAAAGCACATCTTGAATGCCCATTAAGCTCTTTAATCAACTATA
CAGGAAATTAATCTAAAAAGAATATCTATGAATATAAATAAAATTAATGTGCTAGACTCT
GTTCTAAGGCAATTGAAACATCAACACTTGACAGTGTTTGCTTCTAACTTATGAATAGAA
TATATTGTATTAACTTTAAGTGGATTTAGAATTTGATTTTAACAAACTTATCAGACCCTA
AAGTATTTAATGATGAAGAATTGTCTAGAAGTGAAATTAGAGTCTTAGTTGATTCTCAGC
AAATCGATAGCTAGGATAAATTAGATGCATGTAAATTAACAGATTTATCTTTTTATTGCT
TATCTGAAAAAGACAGAATGCTTCTAGCAGTTATTCCTTCCCACCACTCACAATAGTAAT
AGCCTTTTAGGTTAAAATGCTTAACTTTAGACTTCTTGTCAAACTATATTTAAATTTAAA
AGAGTGCTAAGCTTATATCTGAGACTTTACACAAGATGATTAAAGAATAAGTAGAGCCTG
AAAAAGCAAAAGAAAATAACCAATCAGGATAAAAACTAGCTTAAAATGATGTGAAGCTTC
AGGAAATTGCTGATTAAGATAATAAAGTAGATCTTGATAACTTTTAAAAGTAAGTAACAG
CTTACATAAGCAAGCATGAAGAAGTTTTATAATAGAATATTTAGTTAATACAAATTAAAT
ATCAAGAGGTATTAAAGAAAAAAGAAGAGTTGAAAAATACAAAGGAAAAAACAGAAAGCC
AATTTTATGAAATCATAGAAAACAAATAAAAGAAGTTGTTAGAAAGCAAAAAAAGAATTG
AAGAAAAAAATAAGTCAATCAATTAAAAAATTTAAGAAATTGCTTAAAAATTAAAAGACC
CTAAAGCTTCAAATGAATTAGACAATGTTAAAGAAGCAAATATCACATTTAATGAAAAAT
ATAATGAGTAAATTAAGACATACTATAATAAACTTAAAGAAATCGAAGAATAATACTAAA
AGTACTTCAAAACTAGAAGTGAGTTCTTCAATTCATTAGGTGTTCAAAGCAATACAAACC
TACAAATTGATGAAAACACTTTATAAAAAATTAATGAAACAAGAAATAAGCTAAAATACC
ACATGAAAATCCTTGATAATTAGATCATTTAAACCAATCCTCAAGATAATTGA


>TTHERM_00455610(protein)
MENNLLESRLNKILSDKKFSKLNKSIEKHLNKETGIFIKDYFLVLEYESLDEKVIQSKKK
ELLENSMHDHIEKDDDSVQYFALYLWIFNLTAGQFLENNENKLATRIPVNLQSYNMFNAQ
DQQIQSAKNTIESFGNVFCMSKKIGEQSLQIINSNIDEYQIAIYSEKQIFVGHIENIINS
YFIKQSKDDQNAFTMYRVQLFIQKYSPSILSIKFHKLSPHHLAVLLDDQYFCVYNLQSSL
SYQEVQFNLQQLPRFGRNEEYNYQEKGQVQFVDFEFGGNSFFTSYSKTNFQIPSDFDFLS
VYFLTEDGQIYYQSPFLVKDMRINRQLIEELKDYLVQELKLVEQHEQIQEKLQVLKSYLD
LVEQIDSRDLISECEQPTKLSKIVTQTDKSSSFEVPIFNSISMQDLLNDDFQIQLRYVPT
EQNNEDDQENLENNSNLQSQFKSSGFGTKSNIQVFSKSLMDRFTRDNKNQIMYRKYSKFH
KVETKGQLHVFILTKQIGNKTYSTVSSRFSPLPVMPTHIVQDFYQFCLLSGEKAHLECPL
SSLINYTGNQSKKNIYEYKQNQCARLCSKAIETSTLDSVCFQLMNRIYCINFKWIQNLIL
TNLSDPKVFNDEELSRSEIRVLVDSQQIDSQDKLDACKLTDLSFYCLSEKDRMLLAVIPS
HHSQQQQPFRLKCLTLDFLSNYIQIQKSAKLISETLHKMIKEQVEPEKAKENNQSGQKLA
QNDVKLQEIADQDNKVDLDNFQKQVTAYISKHEEVLQQNIQLIQIKYQEVLKKKEELKNT
KEKTESQFYEIIENKQKKLLESKKRIEEKNKSINQKIQEIAQKLKDPKASNELDNVKEAN
ITFNEKYNEQIKTYYNKLKEIEEQYQKYFKTRSEFFNSLGVQSNTNLQIDENTLQKINET
RNKLKYHMKILDNQIIQTNPQDN