Identifiers and Description

Gene Model Identifier

TTHERM_00460480

Standard Name

COM1 (Meiotic double-strand break-induced reCOMbination 1)

Aliases

PreTt25699 | 54.m00155 | 3823.m01074

Description

COM1 hypothetical protein; Com1p is required for meiotic double-strand break repair and full homologous pairing; homolog of S. cerevisiae COM1/SAE2

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10790.1 9.997093137033517e-262
Description: hypothetical protein (634 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26519827: Lukaszewicz A, Shodhan A, Loidl J (2015) Exo1 and Mre11 execute meiotic DSB end resection in the protist Tetrahymena. DNA repair 35( ):137-43
  2. Ref:20422424: Lukaszewicz A, Howard-Till RA, Novatchkova M, Mochizuki K, Loidl J (2010) MRE11 and COM1/SAE2 are required for double-strand break repair and efficient chromosome pairing during meiosis of the protist Tetrahymena. Chromosoma 119(5):505-18

Sequences

>TTHERM_00460480(coding)
ATGCTTGGGTTAGAATAAAATTGTTTTATTAAAGAATACAGGAAGTAGGTAGATAAAGAG
GCTCTAAATTAAATATAAGATGCTGCTTTATCAAATTTAATGAATGCATTTGGGTAGATG
AATTAAACATATTCTGTACTTTTCAAAGATATTTGTCTTACTTTTGGCGCTTTATTATCA
ATAAAGGAAGAGTTAAAGGACTATCGCTAGGAAATGTTTTAGAAATAAAGCGAGAAAATT
ATCTAGGAGAAGATTCAGAAGGAAATGATTCAATAAAAAGATGAGCAATTGGAATTCCTC
TAAAAGTAATTGAAAATAGTTTAACTGCAATCTGATTAAGATAGAAATTCTAAACAGGCA
ATTCAAGAGAGGGATTAGGCCATAAGTTCATATAAATAAAGACTTTTTGATTTATAAGAA
AATGAAAAGAAATTGCTCAGCGAAAAGTCTTAGCTTCAGACTAGAATTGAGTTACTTGAA
GAATAATAAAATTCTAACAAAGTTGCAATCTTAGAAAAGCAAACCACTCTTCATTAAGGT
TATAAACTCACATTTTTAAATAACGAATTAAAAGAATCTCTTATTGAACAACCTTCAAAT
GTATTTTAATAAGAAAACGGGGTTAATAAAAATAAAATATATAGCTTGGATAATAATTAG
ATATAAAAGAATAATACTTCCCTTTTAAGTAAATTTAAGTAAGACCAATCTGATTAAGAG
GTGTAAAATAATACATAACTTGCTCAAAAAAACTAATAGGATATTTATTATAGTAACAAA
ATAAATCAGATAAAACCTGAAACATTTTCAAATCAAGATCCTTCAGTTTATTTACAAGAA
AGCTATGTATAAAGTTCACTTAATGCAAATAATATTTTAGGTTCAAAAAAGATTACAGAT
GAAGAGATTTTTATGATGTAAAAAAGAGAAGCTGAAATTAAAAAAAAGAAATAGGAAGAT
GAACATTTAAAGAATTAATAATACATGTCAAGTTTGAATTACAATAAAATAATTTCTGAT
AAAAATAAAAATTAGAATTTAATGAATAATAAAATTATTGAGTAATCTAAAGAGAGTTCT
ATGGGATCTTTATTCAATAAGACAGCTTTTGATCAAAGCTCAATTAATAATCAAAGTAAT
GCTAGTGTAAGAATGGAATTAGAAGATTCTAGTGCTGGATAACAGCTTTAAAGATATAAA
GTAAGCTTAAATGATAGAAAAATGGTAGCTGAAAATAATCTAAATGCAACAGATGATTTA
TTAAAAAATAAAATGGAGCAGGAAGATAATGAAAAAGAGAGTTCTGACTCTTAGTATAAC
TGGAATTTAAAAATCGATTTGAAAAACAATAACGAATAATAGCAGCAATTTCCATAGGAA
AGCAATAACAATAGTGGAAACAAAAAGAGATTCAAAAAGTAACAATTAAAAAAATCAGAT
TCTTTTGCCACAAATGCAAACTAGAATTCTGAATTAGAAAACACCACAGCTAGTGTTATT
AGTTTACAAAACTAACAATAAAATTAAAATTATGAAATTTAAGATCAATAAAGCAATTAA
ATGCTCTTAGGTCAAAAGAAAAATTTAAATATTAATAAAGGTAGAGTTGCTAATAATAAA
TTTATGAAAGACATAGAATTAGATGATGAAAGTGGGGACAAAGACTAACCCTAATAAAAT
GATATATTTGCTCAGTTTCAATATAAAAAAAGAGGTACTTCAAACTAAGAAGTTCAAGTA
GCTGAAACTTTTAACATGTATAACAAATAAAATTAGAGACCATTAAATCCTCGTAAAAAA
GAAGATAGAGAAAAATTAAAAACTTTTAATTGTGGCAGATGCAAAGCCGCATATCAAACT
TTGGGAGAAGAATTCTGTGGTAATTGTTCTAAACACAGATCAGAATACACGCCTCCTCAC
ACTCCCGAAGCCCATTATTAAAAATTTTCCTAGTCAGAAGATGATTCTAATTGA


>TTHERM_00460480(gene)
ATGCTTGGGTTAGAATAAAATTGTTTTATTAAAGAATACAGGAAGTAGGTAGATAAAGAG
GCTCTAAATTAAATATAAGATGCTGCTTTATCAAATTTAATGAATGCATTTGGGTAGATG
AATTAAACATATTCTGTACTTTTCAAAGATATTTGTCTTACTTTTGGCGCTTTATTATCA
ATAAAGGAAGAGTTAAAGGACTATCGCTAGGAAATGTTTTAGAAATGTAAAATTTGAGAA
ATTTCGATTAAAGAAATGCAAAGTTATTCAAATTTTATTATCAATAGAAAGCGAGAAAAT
TATCTAGGAGAAGATTCAGAAGGAAATGATTCAATAAAAAGATGAGCAATTGGAATTCCT
CTAAAAGTAATTGAAAATAGTTTAACTGCAATCTGATTAAGATAGAAATTCTAAACAGGC
AATTCAAGAGAGGGATTAGGCCATAAGTTCATATAAATAAAGACTTTTTGATTTATAAGA
AAATGAAAAGAAATTGCTCAGCGAAAAGTCTTAGCTTCAGACTAGAATTGAGTTACTTGA
AGAATAATAAAAGTAAATAAATTTGATAATAATTTGTTATCAGAAATAAGTTTAAAAATA
TATTAAAATTTTAAGTATCCAGCTTAGATATTAAAAAATTATTCTTTTCTTTAACTAATA
TAACAGTTCTAACAAAGTTGCAATCTTAGAAAAGCAAACCACTCTTCATTAAGGTTATAA
ACTCACATTTTTAAATAACGAATTAAAAGAATCTCTTATTGAACAACCTTCAAATGTATT
TTAATAAGAAAACGGGGTTAATAAAAATAAAATATATAGCTTGGATAATAATTAGATATA
AAAGAATAATACTTCCCTTTTAAGTAAATTTAAGTAAGACCAATCTGATTAAGAGGTGTA
AAATAATACATAACTTGCTCAAAAAAACTAATAGGATATTTATTATAGTAACAAAATAAA
TCAGATAAAACCTGAAACATTTTCAAATCAAGATCCTTCAGTTTATTTACAAGAAAGCTA
TGTATAAAGTTCACTTAATGCAAATAATATTTTAGGTTCAAAAAAGATTACAGATGAAGA
GATTTTTATGATGTAAAAAAGAGAAGCTGAAATTAAAAAAAAGAAATAGGAAGATGAACA
TTTAAAGAATTAATAATACATGTCAAGTTTGAATTACAATAAAATAATTTCTGATAAAAA
TAAAAATTAGAATTTAATGAATAATAAAATTATTGAGTAATCTAAAGAGAGTTCTATGGG
ATCTTTATTCAATAAGACAGCTTTTGGTAAAACAAATTTATTTATTCTAATTGTTTAAAA
AAATTTAAATTAAATTAATAGATCAAAGCTCAATTAATAATCAAAGTAATGCTAGTGTAA
GAATGGAATTAGAAGATTCTAGTGCTGGATAACAGCTTTAAAGATATAAAGTAAGCTTAA
ATGATAGAAAAATGGTAGCTGAAAATAATCTAAATGCAACAGATGATTTATTAAAAAATA
AAATGGAGCAGGAAGATAATGAAAAAGAGAGTTCTGACTCTTAGTATAACTGGAATTTAA
AAATCGATTTGAAAAACAATAACGAATAATAGCAGCAATTTCCATAGGAAAGCAATAACA
ATAGTGGAAACAAAAAGAGATTCAAAAAGTAACAATTAAAAAAATCAGATTCTTTTGCCA
CAAATGCAAACTAGAATTCTGAATTAGAAAACACCACAGCTAGTGTTATTAGTTTACAAA
ACTAACAATAAAATTAAAATTATGAAATTTAAGATCAATAAAGCAATTAAATGCTCTTAG
GTCAAAAGAAAAATTTAAATATTAATAAAGGTAGAGTTGCTAATAATAAATTTATGAAAG
ACATAGAATTAGATGATGAAAGTGGGGACAAAGACTAACCCTAATAAAATGATATATTTG
CTCAGTTTCAATATAAAAAAAGAGGTACTTCAAACTAAGAAGTTCAAGTAGCTGAAACTT
TTAACATGTATAACAAATAAAATTAGAGACCATTAAATCCTCGTAAAAAAGAAGATAGAG
AAAAATTAAAAACTTTTAATTGTGGCAGATGCAAAGCCGCATATCAAACTTTGGGAGAAG
AATTCTGTGGTAATTGTTCTAAACACAGATCAGAATACACGCCTCCTCACACTCCCGAAG
CCCATTATTAAAAATTTTCCTAGTCAGAAGATGATTCTAATTGA


>TTHERM_00460480(protein)
MLGLEQNCFIKEYRKQVDKEALNQIQDAALSNLMNAFGQMNQTYSVLFKDICLTFGALLS
IKEELKDYRQEMFQKQSEKIIQEKIQKEMIQQKDEQLEFLQKQLKIVQLQSDQDRNSKQA
IQERDQAISSYKQRLFDLQENEKKLLSEKSQLQTRIELLEEQQNSNKVAILEKQTTLHQG
YKLTFLNNELKESLIEQPSNVFQQENGVNKNKIYSLDNNQIQKNNTSLLSKFKQDQSDQE
VQNNTQLAQKNQQDIYYSNKINQIKPETFSNQDPSVYLQESYVQSSLNANNILGSKKITD
EEIFMMQKREAEIKKKKQEDEHLKNQQYMSSLNYNKIISDKNKNQNLMNNKIIEQSKESS
MGSLFNKTAFDQSSINNQSNASVRMELEDSSAGQQLQRYKVSLNDRKMVAENNLNATDDL
LKNKMEQEDNEKESSDSQYNWNLKIDLKNNNEQQQQFPQESNNNSGNKKRFKKQQLKKSD
SFATNANQNSELENTTASVISLQNQQQNQNYEIQDQQSNQMLLGQKKNLNINKGRVANNK
FMKDIELDDESGDKDQPQQNDIFAQFQYKKRGTSNQEVQVAETFNMYNKQNQRPLNPRKK
EDREKLKTFNCGRCKAAYQTLGEEFCGNCSKHRSEYTPPHTPEAHYQKFSQSEDDSN