Identifiers and Description

Gene Model Identifier

TTHERM_00463010

Standard Name

GST42 (Glutathione S-transferase mu 42, TtGSTm42, GSTm42)

Aliases

PreTt25753 | 54.m00209 | 3823.m01122

Description

GST42 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10743.1 1.0002534232488231e-144
Description: glutathione S-transferase domain-containing protein (228 aa)
Oxytricha Contig3021.0.g27 6.002718307283067e-26
Description: Glutathione S-transferase, C-terminal domain
DictyBase DDB_G0268138 0.00000000000020009182674645818
Description: DDB_G0268138 on chromosome: 1 position 1528262 to 1528973
WormBase WBGene00001753 0.00000000009998509410508463
Description: locus:gst-5 Probable glutathione S-transferase 5 status:Confirmed UniProt:Q09596 protein_id:CAA86859.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00463010(coding)
ATGTTGGTTGTAATAATTTATATTTATTTTTATTTTATTAAGTTCAATAAAATTTAGAAA
GCAAAGATAAACAAATAAATAATTATATAAATAGGAATATAGATAAACTTATAGATGGCT
GAAAAAAATTAGATTACATTAGGGTATTGGAATATAAGAGGTTTAGGTTAGCTAAGCAGA
TATCTTCTTGAATACACTGGTCTTAAGTACAAGGAAAAGAGATATTAAAAGCTTGAGGAA
TGGTTCTAAAAGGATAAGTAAGGATTAGGAATAGAATTTGCAAACTTACCTTATTTAATA
GATGGAGATTTAAAATTAACCGAAAGCCACGCAGTAAATCTGTACATTATAAGAAAGAGC
GGCAAGAATGAATTGCTAGGAACTAATCTGATCGAGGAATCTAAAATTAGAGAGCTTATT
GGATATTTAGAAGATTTTTTCAGATAAATATTAACTTTGTGCTTTAATCCTTAATTTAGT
ATCATTAAGTAACAAAAGTATAATGATGACTTTAGCCTAAGATTGCAAAGATTGGAAAAT
CAGCTCACTAAAGACAACAGAAAATGGCTTAATGGTCAATCACTTAGCCTTCCTGATTTT
ATATTCTATGAAATTAGTTAATACATTAAAGGAATCTATCCCGAAGAATTTAAAAAACTG
CCAAAAATCTAAGCCTTCCAAGCCCGTTTTGAAGAAATTGAGTAAATATAAGACTATATG
ATGTCTGAAGAGTACATTTATGCTCCATTCTTAGCAGTTGGTCATGGAGCCTAATGGACT
GGCTTAAAATAAAAATGA


>TTHERM_00463010(gene)
ATGTTGGTTGTAATAATTTATATTTATTTTTATTTTATTAAGTTCAATAAAATTTAGAAA
GCAAAGATAAACAAATAAATAATTATATAAATAGGAATATAGATAAACTTATAGATGGCT
GAAAAAAATTAGATTACATTAGGGTATTGGAATATAAGAGGTTTAGGTTAGCTAAGCAGA
TATCTTCTTGAATACACTGGTCTTAAGTACAAGGAAAAGAGATATTAAAAGCTTGAGGAA
TGGTTCTAAAAGGATAAGTAAGGATTAGGAATAGAATTTGCAAACTTACCTTATTTAATA
GATGGAGATTTAAAATTAACCGAAAGCCACGCAGTAAATCTGTACATTATAAGAAAGAGC
GGCAAGAATGAATTGCTAGGAACTAATCTGATCGAGGAATCTAAAATTAGAGAGCTTATT
GGATATTTAGAAGATTTTTTCAGATAAATATTAACTTTGTGCTTTAATCCTTAATTTAGT
ATCATTAAGTAACAAAAGTATAATGATGACTTTAGCCTAAGATTGCAAAGATTGGAAAAT
CAGCTCACTAAAGACAACAGAAAATGGCTTAATGGTCAATCACTTAGCCTTCCTGATTTT
ATATTCTATGAAATTAGTTAATACATTAAAGGAATCTATCCCGAAGAATTTAAAAAACTG
CCAAAAATCTAAGCCTTCCAAGCCCGTTTTGAAGAAATTGAGTAAATATAAGACTATATG
ATGTCTGAAGAGTACATTTATGCTCCATTCTTAGCAGTTGGTCATGGAGCCTAATGGACT
GGCTTAAAATAAAAATGA


>TTHERM_00463010(protein)
MLVVIIYIYFYFIKFNKIQKAKINKQIIIQIGIQINLQMAEKNQITLGYWNIRGLGQLSR
YLLEYTGLKYKEKRYQKLEEWFQKDKQGLGIEFANLPYLIDGDLKLTESHAVNLYIIRKS
GKNELLGTNLIEESKIRELIGYLEDFFRQILTLCFNPQFSIIKQQKYNDDFSLRLQRLEN
QLTKDNRKWLNGQSLSLPDFIFYEISQYIKGIYPEEFKKLPKIQAFQARFEEIEQIQDYM
MSEEYIYAPFLAVGHGAQWTGLKQK