Identifiers and Description

Gene Model Identifier

TTHERM_00463140

Standard Name

RRP45 (exosome component RRP45)

Aliases

PreTt25766 | 54.m00222 | 3823.m01134

Description

RRP45 3-prime exoribonuclease family 1 protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10735.1 9.997093137033517e-262
Description: hypothetical protein (364 aa)
DictyBase DDB_G0271100 6.000608367221491e-63
Description: DDB_G0271100 on chromosome: 2 position 47597 to 49269
Oxytricha Contig12411.0.g65 6.001950283815408e-48
Description: 3 exoribonuclease family, domain 1
SGD YDR280W 8.003782782428492e-46
Description: RRP45 Exosome non-catalytic core component; involved in 3-5 RNA processing and degradation in both the nucleus and the cytoplasm; has similarity to E. coli RNase PH and to human hRrp45p (PM/SCL-75, EXOSC9)
WormBase WBGene00018154 5.999907735769095e-44
Description: locus:exos-9 status:Confirmed UniProt:Q20128 protein_id:CCD70741.1
Stentor Coeruleus SteCoe_9780 1.9287498479639178e-22
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00463140(coding)
ATGTAGGTATTGAGTTAAAATGAGAGCGATTTTGTTCTCTCAGGCTTGGAAAATGAGATT
AGATTAGATGGAAGAAAGTTGATGGATAGCAGAAACATTAAGGTTATTTTTGGAAATAAC
GTAGGAGAAATAGAAGTTTTAATTGGAGACACTCATATAATTACAAAAACAACTGCTGAA
ATCATTTAGCCAAAATAAGAAAAGCCTAATGAAGGCTCTCTTAAATTTAATGTTGATTTA
TCATCTATGCAAGATGAGCAACAACCAAACAATGTTAACATTAAAAAATATTCAAATGAA
ATCTAAAAATTGTTAGAAAAAATAATCAAGGGATCAAAAGCAATCGATATGGAAAGCTTG
TGTATAGTAACAAATAAGAGAGTATGGTCAATTAACGTAGATAGTTCGGTAGTTTCAAAC
GGTGGTAACCTAATTGATGCTATTTACTTATCTGTAATTATTAGTTTACTGCATTTCAGA
AAGCCTTATGTCTCTGTAGAATAGCAATCAAACATTAAAATTCACACTGAAAAAAATCCT
TAACCACTATCTATTCATCATATTCCTATTCCATTTACATTTGCTTTCTTCAAAAAGTCA
ACACTTTTAGTTTCTGATCCACTAGTACTTGAAGAGCAAATCATGGAAGGAAGACTAACT
ATTTCAGTTAATATTTATAATGATGTGTGCAATATTCATAAGCCTGGTGGTGCACCAATC
AAATTAGAATTAATTAATAAGCTTGTTGAAGTTTGCTTGAATAAAATAAAATAAATGACA
GATTTTGTGAGACAAATACTGAAAGAGTGTAATAAGCATAGTATTAACTAAATAAAGGAA
GAAAGCAAAATCATTACATTAAACTTCCCCTAAATAGTTAGTGCATCTCAAACATCTAAT
TAAATTCCATCAAACAAAATGGAGGAAGAGGAAGAGTAATATAAAGTTAGTAAAGAAGAA
ATTAAAAACTTGTTGGAAAGTAGAAATTGA


>TTHERM_00463140(gene)
ATGTAGGTATTGAGTTAAAATGAGAGCGATTTTGTTCTCTCAGGCTTGGAAAATGAGATT
AGATTAGATGGAAGAAAGTTGATGGATAGCAGAAACATTAAGGTTATTTTTGGAAATAAC
GTAGGAGAAATAGAAGTTTTAATTGGAGACACTCATATAATTACAAAAACAACTGCTGAA
ATCATTTAGCCAAAATAAGAAAAGCCTAATGAAGGCTCTCTTAAATTTAATGTTGATTTA
TCATCTATGCAAGATGAGCAACAACCAAACAATGTTAACATTAAAAAATATTCAAATGAA
ATCTAAAAATTGTTAGAAAAAATAATCAAGGGATCAAAGTAAATAATTAATAAATGATTT
AATTTTTATAAAAGGAACTATTTTAAATTTTAATTGAAATAATTAGAGCAATCGATATGG
AAAGCTTGTGTATAGTAACAAATAAGAGAGTATGGTCAATTAACGTAGATAGTTCGGTAG
TTTCAAACGGTGGTAACCTAATTGATGCTATTTACTTATCTGTAATTATTAGTTTACTGC
ATTTCAGAAAGCCTTATGTCTCTGTAGAATAGCAATCAAACATTAAAATTCACACTGAAA
AAAATCCTTAACCACTATCTATTCATCATATTCCTATTCCATTTACATTTGCTTTCTTCA
AAAAGTCAACACTTTTAGTTTCTGATCCACTAGTAATAAATAAATCAATACATAATTAAT
TCTATTCTAAAAAAGTCATTGAATATTAGTTGTTATCTCAAATAAATTAAAGATATTTTT
TATATTAATTATTTATTCATTTAAATTAATATTCTATTAAGGTACTTGAAGAGCAAATCA
TGGAAGGAAGACTAACTATTTCAGTTAATATTTATAATGATGTGTGCAATATTCATAAGC
CTGGTGGTGCACCAATCAAATTAGAATTAATTAATAAGTAGATGTTTTTATTATTAAATA
TATTATAATGCTAATTATTAATATTTCGAATAGGCTTGTTGAAGTTTGCTTGAATAAAAT
AAAATAAATGACAGATTTTGTGAGACAAATACTGAAAGAGTGTAATAAGCATAGTATTAA
CTAAATAAAGGAAGAAAGCAAAATCATTACATTAAACTTCCCCTAAATAGTTAGTGCATC
TCAAACATCTAATTAAATTCCATCAAACAAAGTAATTTCTTTAAAAAATAATATTTATAT
TATAAATTAACATAAAATAAATAGATGGAGGAAGAGGAAGAGTAATATAAAGTTAGTAAA
GAAGAAATTAAAAACTTGTTGGAAAGTAGAAATTGA


>TTHERM_00463140(protein)
MQVLSQNESDFVLSGLENEIRLDGRKLMDSRNIKVIFGNNVGEIEVLIGDTHIITKTTAE
IIQPKQEKPNEGSLKFNVDLSSMQDEQQPNNVNIKKYSNEIQKLLEKIIKGSKAIDMESL
CIVTNKRVWSINVDSSVVSNGGNLIDAIYLSVIISLLHFRKPYVSVEQQSNIKIHTEKNP
QPLSIHHIPIPFTFAFFKKSTLLVSDPLVLEEQIMEGRLTISVNIYNDVCNIHKPGGAPI
KLELINKLVEVCLNKIKQMTDFVRQILKECNKHSINQIKEESKIITLNFPQIVSASQTSN
QIPSNKMEEEEEQYKVSKEEIKNLLESRN