Identifiers and Description

Gene Model Identifier

TTHERM_00463280

Standard Name

OLE1 (OLEic acid requiring)

Aliases

PreTt25780 | 54.m00236 | 3823.m01147

Description

OLE1 fatty acid desaturase; Putative fatty acid desaturase; mRNA expression and stability increases upon decreased temperature; sequence similarity to delta-9-acyl-CoA desaturases from yeast- rat- and mouse

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10724.1 9.997093137033517e-262
Description: fatty acid desaturase (293 aa)
WormBase WBGene00001398 9.99562814099401e-84
Description: locus:fat-6 Delta(9)-fatty-acid desaturase fat-6 status:Partially_confirmed UniProt:G5EGN2 protein_id:CAB08356.1
DictyBase DDB_G0273837 5.001636743996964e-56
Description: scdB-2 on chromosome: 2 position 3466919 to 3469700
SGD YGL055W 5.0007856079333316e-54
Description: OLE1 Delta(9) fatty acid desaturase, required for monounsaturated fatty acid synthesis and for normal distribution of mitochondria

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:10735176: Nakashima S, Nozawa Y (1999) Stress-responsive gene expression in Tetrahymena. Acta biologica Hungarica 50(4):413-24
  2. Ref:8694777: Nakashima S, Zhao Y, Nozawa Y (1996) Molecular cloning of delta 9 fatty acid desaturase from the protozoan Tetrahymena thermophila and its mRNA expression during thermal membrane adaptation. The Biochemical journal 317 ( Pt 1)( ):29-34

Sequences

>TTHERM_00463280(coding)
ATGAACGTTAAAAATAAAATTAAATTAAAGTAAAATAAAATAAAAAAAATATACAAATAG
AATAAACTCACTCACACATACACACAAATGGGAGTATACTCTAAAGGTGAATTCAAGGTC
ATGGGTTATGAACTCAAGAAAGAGTATTGCATATGGTTAGGTTATATGCACATACTTGCT
GTAGCTGGTCTTATCTACTGGCTTTTATAAGAAAAGGAATTGTTCACAAAGAGTCTTTAC
ATGTTCCTTATTTTCCACTTGATGGGAGGTTTAGGTATTACTGCTGGCTCACATCGTCTC
TGGGCTCACAGAAGTTACACTGCCAAGACTCCCTACAGAATTTTGGTTATGCTCTTTAAC
AGCATGGCCTTCTAAGGTTCTATTTTCCACTGGAGCAGAGACCACAGACTCCACCATAAA
TTCTCGGACACAGATATTGATCCTCACTCAATGAACAAGGGATTCTTCTTTGCTCACGTT
GGCTGGTTACTTGTCAAGAAATCTCCTGAACTTAAAAAGGAAGGTGAAAAATTGAATATT
TAGGATCTTAAGGATGACCCTGTTGTTATGTTCCAAAAGAAGCACTACTTCTTGATTTCT
ACATTGGTCTGCTTTGTTATTCCAACTGTCATTATGCAATACACCATTGGAGGAGGATTC
ATCTACAACTTTTTGATGAGCTGTTTCAGATACGTCTTTATGCTTCACACTACCTGGTGT
GTAAACAGTGTATGCCACATGTTTGGTAGCAGACCTTATAACGAGTCTATTTTACCCACT
GAAAACCTCTTCGTTAGTATTATTGCTCTCGGTGAAGGATGGCACAACTGGCATCACGAA
TACCCCAGAGATTGGAGAGCTGCCGAAAATAAATGGACTAAGATCAACTTTACTTCCGGC
TTTATCAAGTTCTTCGAATTTTTGGGTCAATGTGATACCAATGGAATTAAGAAAAACGAA
TCTTGA


>TTHERM_00463280(gene)
ATGAACGTTAAAAATAAAATTAAATTAAAGTAAAATAAAATAAAAAAAATATACAAATAG
AATAAACTCACTCACACATACACACAAATGGGAGTATACTCTAAAGGTGAATTCAAGGTC
ATGGGTTATGAACTCAAGAAAGAGTATTGCATATGGTTAGGTTATATGCACATACTTGCT
GTAGCTGGTCTTATCTACTGGCTTTTATAAGAAAAGGAATTGTTCACAAAGAGTCTTTAC
ATGTTCCTTATTTTCCACTTGATGGGAGGTTTAGGTATTACTGCTGGCTCACATCGTCTC
TGGGCTCACAGAAGTTACACTGCCAAGACTCCCTACAGAATTTTGGTTATGCTCTTTAAC
AGCATGGCCTTCTAAGGTTCTATTTTCCACTGGAGCAGAGACCACAGACTCCACCATAAA
TTCTCGGACACAGATATTGATCCTCACTCAATGAACAAGGGATTCTTCTTTGCTCACGTT
GGCTGGTTACTTGTCAAGAAATCTCCTGAACTTAAAAAGGAAGGTGAAAAATTGAATATT
TAGGATCTTAAGGATGACCCTGTTGTTATGTTCCAAAAGAAGCACTACTTCTTGATTTCT
ACATTGGTCTGCTTTGTTATTCCAAGTAATTTTTTTTCTTTTATAAATACAAAAAAATTA
TAATAAATTTTGCCAATCGCGAAAACAAACAAACAAACAAACAATCTATAAATAAATTAT
CAATTTACTTAGTCATTTGCATAAATGGCTGTTAAGAAATTGAAACAATAAAAAGTGTTC
ATAAATCCAAATTTAAAATGAATTTTGATAAAAAAGCTTGTTAAAAAAAATCATTTTGAT
TCATTAATTAATTTATGCCAGTTTAAATATTCTAGAAAACTAATTTTTATTAAGCTAAAT
ATTCTAAACATCAATTTAATATTTAATAGCTGTCATTATGCAATACACCATTGGAGGAGG
ATTCATCTACAACTTTTTGATGAGCTGTTTCAGATACGTCTTTATGCTTCACACTACCTG
GTGTGTAAACAGTGTATGCCACATGTTTGGTAGCAGACCTTATAACGAGTCTATTTTACC
CACTGAAAACCTCTTCGTTAGTATTATTGCTCTCGGTGAAGGATGGCACAACTGGCATCA
CGAATACCCCAGAGATTGGAGAGCTGCCGAAAATAAATGGACTAAGATCAACTTTACTTC
CGGCTTTATCAAGTTCTTCGAATTTTTGGGTCAATGTGATACCAATGGAATTAAGAAAAA
CGAATCTTGA


>TTHERM_00463280(protein)
MNVKNKIKLKQNKIKKIYKQNKLTHTYTQMGVYSKGEFKVMGYELKKEYCIWLGYMHILA
VAGLIYWLLQEKELFTKSLYMFLIFHLMGGLGITAGSHRLWAHRSYTAKTPYRILVMLFN
SMAFQGSIFHWSRDHRLHHKFSDTDIDPHSMNKGFFFAHVGWLLVKKSPELKKEGEKLNI
QDLKDDPVVMFQKKHYFLISTLVCFVIPTVIMQYTIGGGFIYNFLMSCFRYVFMLHTTWC
VNSVCHMFGSRPYNESILPTENLFVSIIALGEGWHNWHHEYPRDWRAAENKWTKINFTSG
FIKFFEFLGQCDTNGIKKNES