Identifiers and Description

Gene Model Identifier

TTHERM_00463370

Standard Name

RRP61 (exosome component RRP6-1)

Aliases

PreTt25789 | 54.m00245 | 3823.m01156

Description

RRP61 3-prime-5-prime exonuclease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10720.1 2.0000211193600847e-137
Description: 3-5 exonuclease (1301 aa)
SGD YOR001W 5.998760051700188e-30
Description: RRP6 Nuclear exosome exonuclease component; has 3-5 exonuclease activity; involved in RNA processing, maturation, surveillance, degradation, tethering, and export; has similarity to E. coli RNase D and to human PM-Sc1 100 (EXOSC10); mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay
DictyBase DDB_G0271572 3.0000451088882257e-25
Description: exosc10 on chromosome: 2 position 601251 to 605014
WormBase WBGene00000796 8.00344477495519e-22
Description: locus:crn-3 status:Confirmed UniProt:G5EBX6 protein_id:CAA90108.1
Oxytricha Contig14024.0.g55 9.997019043202629e-21
Description: 3-5 exonuclease
Stentor Coeruleus SteCoe_17151 0.00000000003775134544279098
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00463370(coding)
ATGAAAAATCCATTTGACAGCAATAAATATTTTATGAACGAGAATTTAAATTTGGCTTTT
GAAAATATTTCAAAGCCTCAGCTGTTATTTAACGATAGCTATTTTACTGTCAGTAACAAT
ACTTAGTTGTAGAACCAATCGCAAGGCTAGCTTGTTGAAAAAATTAAAGCAATATAAAAC
AATATCATTCCTTACAACGAAATAAGATTCTTTTAAAATCTAAGAAACATACAAGCATGT
TTTACTTTTGACTTCGATAAAGACCAATCCAAATCATTGTACATTAAAACAGACTAAGAA
TTTAACAGAATGTTAGAGCTCTTGAGAAATGCTGGAGTCATATGCTGGGATGTGCATTTC
AATACTTACAGAAGTTTCTATGGTTTTGTTTGCTTTCTAGAAATTAGTACAATTGATCAA
GATTATATCATAGATTGCTTAAGTTTGAGAAATGAAATACATAGATTAAAGGAAATCTTT
TTGGATAAGTAGATTGTTAAAATAACTTTGGATTTACAAGAAAAAATAAATTGGCTTTAC
AGAGATTTTGGAATCTTAAATATCGTTAATAGCATTGATTTAAGTCTTTATTTAAAAGAA
TTAAATTTGCCTTCAATAATTTCTTATTTGTGTGGGACACTGTTGAATTATCCTTTTCAA
AAAATACTGCAAAACTTTGATTATCGTAAAAGACCTCTTAGCTTAAATGAAATTAATTAT
TTAAGAGCTTTTAGTTACTTTCCTTTGAGGATACTATCTATCCTAACAAATAATATCCTT
TCTATTGAAAAAAGTAAACTTGAAGAGCTATTTAACAAGAGTTAATTGGCTTCTTGTTTG
AGCTTAAAGCAACTAGAAAATCTCCTTTAAGAGAACTTAATTGAGAAACACTTTGAAATG
TTCTGTATTGATAGAAATTACAACGAACAATAACAATATTTTTTGAGAAAAATTTTGAAG
TGGAGAATACAGAGAGCCAAATTAGAAGATGAAAGTGTTGAATATATCTTCCCTGCATGC
ATAATTGAGAAATTTATTTCAGTGTATCCAACTTCTTCATAATAAGTGTTAGATGAATTA
GTAAAATATCAGCAAGAAATAAACCTCTAGCACTATGAAACATTTTACTCTTTTTTTGAT
GAGAGAAGCTATCAAAATTACAAAGAAAAGAATAGATTTAAACATGATACAAAATAATAA
CAACAATAAACCTATTAAATATAGCAAACTTAGCAAATGCAATCACCAACTCCCAAAAAA
ATGCAATCTATCCAAGGAAGCACTAACTAAACTCCTTAATTGCAAAAAGAGAATTCGCAG
CAATAAAACTAAGAATCCCCTCCTCTTAGTCCAACTTCTTTATTAAAAGCAGTTAACTGG
GTGGTAAAAAATCCGAACCATGAAGGAACACCAGAAAAAAATTACAAAAAATTGATAAGC
AGATAAAGTTTATCACCTTCGATACTAAAATATTCCCCATAAAATGGAGTTGATTCGCCT
TAACATGATAATATCATGAAGGATTTATTATGTGTAATCAATGAGAGAAACTCTAAACAA
TCCTAAGTTAAATTTTAGCATTCTGTTTAGAGAGAACTGAGTAGAATAAATAACATGGAG
GACACAAATGATACTGAAGAAGAGCAGTAATAAAAGGAAGACACTTTCTAAATGAACCTA
TTAAATAAGTTATAATCAAAATAATACTACATAAAAAACTCTAAAGAAAACCTTCCAAAC
AATATTACAGATATCTTTGAATTAGCTAATCGTAAAAGAAAGAAAAATAAAGATAAAAAG
AGAAAGAAAGAAGAAAAGTCACCACAATTAACTGCTTAGGTAAATAAATAAATAAACACA
CACACATTTCAATAAACTCTTTTTTTTAATTTAATCATTTTATTTATTTGTTTTATTAAT
TTAATAATTTATTTTACATTAAATTCTAAAAGAAGGAACAAAAAGAAAAAGAAAAATTAA
ATATAGATAAGCTTCTAAAAGACTTGA


>TTHERM_00463370(gene)
ATGAAAAATCCATTTGACAGCAATAAATGTAAGATAGCAGTTTGATTTTTCCATTCAATT
TAACAAATAGTCTTAAACATAAATAACTTCATCAATTTTATAATATGGCAGATTTTATGA
ACGAGAATTTAAATTTGGCTTTTGAAAATATTTCAAAGCCTCAGCTGTTATTTAACGATA
GCTATTTTACTGTCAGTAACAATACTTAGTTGTAGAACCAATCGCAAGGCTAGCTTGTTG
AAAAAATTAAAGCAATATAAAACAATATCATTCCTTACAACGAAATAAGATTCTTTTAAA
ATCTAAGAAACATACAAGCATGTTTTACTTTTGACTTCGATAAAGACCAATCCAAATCAT
TGTACATTAAAACAGACTAAGAATTTAACAGAATGTTAGAGCTCGTAAAATCTTTTATTA
AAAAAATGGTTTTTATTTACAGATTTAAAATAATTTGAAAAGTTGAGAAATGCTGGAGTC
ATATGCTGGGATGTGCATTTCAATACTTACAGAAGTTTCTATGGTTTTGTTTGCTTTCTA
GAAGTACTTAAATTGTTGCCAATTAATCATAAATTTGAACATTTTTTATAAGATTCCTAA
TAAAATATTTACTTAGGATGATATATTTTTGTTTAAAATACATTTGATATCTTGATAGAT
AGATCTACAATACAAACAAATACTTGATTTTAATATTCATTTTTATCATTAAAGATTAGT
ACAATTGATCAAGATTATATCATAGATTGCTTAAGTTTGAGAAATGAAATACATAGATTA
AAGGAAATCTTTTTGGATAAGTAGATTGTTAAAATAACTTTGGATTTACAAGAAAAAATA
AATTGGCTTTACAGAGATTTTGGAATCTTAAATATCGTTAATAGCATTGATTTAAGTCTT
TATTTAAAAGAATTAAATTTGCCTTCAATAATTTCTTATTTGTGTGGGACACTGTTGAAT
TATCCTTTTCAAAAAATACTGCAAAACTTTGATTATCGTAAAAGACCTCTTAGCTTAAAT
GAAATTAATTATTTAAGAGCTTTTAGTTACTTTCCTTTGAGGATACTATCTATCCTAACA
AATAATATCCTTTCTATTGAAAAAAGTAAACTTGAAGAGCTATTTAACAAGAGTTAATTG
GCTTCTTGTTTGAGCTTAAAGCAACTAGAAAATCTCCTTTAAGAGAACTTAATTGAGAAA
CACTTTGAAATGTTCTGTATTGATAGAAATTACAACGAACAATAACAATATTTTTTGAGA
AAAATTTTGAAGTGGAGAATACAGAGAGCCAAATTAGAAGATGAAAGTGTTGAATATATC
TTCCCTGCATGCATAATTGAGAAATTTATTTCAGTGTATCCAACTTCTTCATAATAAGTG
TTAGATGAATTAGTAAAATATCAGCAAGAAATAAACCTCTAGCACTATGAAACATTTTAC
TCTTTTTTTGATGAGAGAAGCTATCAAAATTACAAAGAAAAGAATAGATTTAAACATGAT
ACAAAATAATAACAACAATAAACCTATTAAATATAGCAAACTTAGCAAATGCAATCACCA
ACTCCCAAAAAAATGCAATCTATCCAAGGAAGCACTAACTAAACTCCTTAATTGCAAAAA
GAGAATTCGCAGCAATAAAACTAAGAATCCCCTCCTCTTAGTCCAACTTCTTTATTAAAA
GCAGTTAACTGGGTGGTAAAAAATCCGAACCATGAAGGAACACCAGAAAAAAATTACAAA
AAATTGATAAGCAGATAAAGTTTATCACCTTCGATACTAAAATATTCCCCATAAAATGGA
GTTGATTCGCCTTAACATGATGTAAAAAATTTATTTGAATAAGTTTAAGATTGAAAAAGT
TTTTTTATTAAAAGAATATCATGAAGGATTTATTATGTGTAATCAATGAGAGAAACTCTA
AACAATCCTAAGTTAAATTTTAGCATTCTGTTTAGAGAGAACTGAGTAGAATAAATAACA
TGGAGGACACAAATGATACTGAAGAAGAGCAGTAATAAAAGGAAGACACTTTCTAAATGA
ACCTATTAAATAAGTTATAATCAAAATAATACTACATAAAAAACTCTAAAGAAAACCTTC
CAAACAATATTACAGATATCTTTGAATTAGCTAATCGTAAAAGAAAGAAAAATAAAGATA
AAAAGAGAAAGAAAGAAGAAAAGTCACCACAATTAACTGCTTAGGTAAATAAATAAATAA
ACACACACACATTTCAATAAACTCTTTTTTTTAATTTAATCATTTTATTTATTTGTTTTA
TTAATTTAATAATTTATTTTACATTAAATTCTAAAAGAAGGAACAAAAAGAAAAAGAAAA
ATTAAATATAGATAAGCTTCTAAAAGACTTGA


>TTHERM_00463370(protein)
MKNPFDSNKYFMNENLNLAFENISKPQLLFNDSYFTVSNNTQLQNQSQGQLVEKIKAIQN
NIIPYNEIRFFQNLRNIQACFTFDFDKDQSKSLYIKTDQEFNRMLELLRNAGVICWDVHF
NTYRSFYGFVCFLEISTIDQDYIIDCLSLRNEIHRLKEIFLDKQIVKITLDLQEKINWLY
RDFGILNIVNSIDLSLYLKELNLPSIISYLCGTLLNYPFQKILQNFDYRKRPLSLNEINY
LRAFSYFPLRILSILTNNILSIEKSKLEELFNKSQLASCLSLKQLENLLQENLIEKHFEM
FCIDRNYNEQQQYFLRKILKWRIQRAKLEDESVEYIFPACIIEKFISVYPTSSQQVLDEL
VKYQQEINLQHYETFYSFFDERSYQNYKEKNRFKHDTKQQQQQTYQIQQTQQMQSPTPKK
MQSIQGSTNQTPQLQKENSQQQNQESPPLSPTSLLKAVNWVVKNPNHEGTPEKNYKKLIS
RQSLSPSILKYSPQNGVDSPQHDNIMKDLLCVINERNSKQSQVKFQHSVQRELSRINNME
DTNDTEEEQQQKEDTFQMNLLNKLQSKQYYIKNSKENLPNNITDIFELANRKRKKNKDKK
RKKEEKSPQLTAQVNKQINTHTFQQTLFFNLIILFICFINLIIYFTLNSKRRNKKKKKNQ
IQISFQKT