Identifiers and Description

Gene Model Identifier

TTHERM_00463710

Standard Name

NTP2 (Nucleoside transporter 2)

Aliases

PreTt25823 | 54.m00279 | 3823.m01189

Description

NTP2 equilibrative nucleoside transporter family protein; Nucleoside transporter family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10695.1 9.997093137033517e-262
Description: nucleoside transporter (426 aa)
Oxytricha Contig18964.0.g30 2.000130478826482e-26
Description: Nucleoside transporter
DictyBase DDB_G0283439 0.000000000029994712494008525
Description: DDB_G0283439 on chromosome: 4 position 699253 to 700845
WormBase WBGene00008123 0.0007999190683310628
Description: locus:ent-6 status:Confirmed UniProt:Q7JKL2 protein_id:CAE46670.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00463710(coding)
ATGAAATAAAAAATATCTGATATTGCTAAACATACCCCTCTTACTAAAATCACATTTGCT
CTTCTCGGAACTAACACTTTATTAGGCTGGAGCGCTGTTTTAACATCTTTTGATTACTTT
AGTGACAAATTCCCTTAAGATGAGTTTCCTGATGTTGCATTTTACTTTCCAATCCCATTG
AAAATAGGAACTTTTATTTGGACTTTTGCAATGGCCTTTTTGATGAAGCATATATCTTTA
AAATTTAGAATATGTGGATTCATTGCTATTTAAGGAGTTTTAATGATGCTCTTACCTATA
ATTGCAAATTATATGTAGACCAATTTAGGTTACGCTTTAATGATAACTATTTGCTTTCTA
GTCGGATCAACTGCATGTATTGTTCAAAATTCAAACCTCGCTCTTGTCTCAAATTTTGAT
AAGCTAAGCTTGAAACTATATTGGGTATTTACTTCTATAACTCAATTGATTATGAATCTA
TGCAGAGCTATCATTCTTGTAATTTTTGGTGACAATTAGGAAGGTATTAATACAGGAATA
TTTGTTTATTATGCAGTTGCTGATCTTGTGATGATAATAACTATAATTTCAGTTATAAAA
TTCCTAAAAACATCATTTTATCTGGATATGCTTGAAATAAATAAATTACAATTATAAAAC
GAAAGCGAAAACACTGATGATGAAAACCAAGTATAATAATAAGAATCGATTTCTAATCTA
TCTTCTAGCTAAATTTAACATCAAGCTGAGTAGTCTTTGCTCTAAAAATAAAATAAAATT
TAAATGGCTAAAAATTGTTTCATGAAAGTGAAATTCATTTGTTTTTCAATTTTATTGACT
TACATTATTTAATACATGCTTTTCCCAGGAGTGGCTGTTTTCTAAAAATAATATCATATG
ATTCATTCTAAAGCTTGGGCTACTTTGAGCATGCAAATAGTTTACAGTGTTGGAGACTTA
GTTGGAAAGTATCTGAGTACATTTAATTTTTATAATACTACCGCTCTCTATGCGATATCC
TTAAGCAGATTATTCTTATTCTTTACATTTTTAATGATTGCTCATGATTATGAATCTTCC
TTCTTTTAGAATGACATATTTGCCTTCATTAATATATTTAGCTTAAGTTTTACTAATGGA
TTTGTTACAGGAGGGTTTATGACAATTGGTCCTCAAAGAGGTTCTAATAACTAAGAAAGA
AGCTTAATATCAATAATCTAAACTTTCTTCTTGACATTTGGAATTTCTGTAGGCACATTT
TTAGCTCTTACACTAAAATTTTGA


>TTHERM_00463710(gene)
ATGAAATAAAAAATATCTGATATTGCTAAACATACCCCTCTTACTAAAATCACATTTGCT
CTTCTCGGAACTAACACTTTATTAGGCTGGAGCGCTGTTTTAACATCTTTTGATTACTTT
AGTGACAAATTCCCTTAAGATGAGTTTCCTGATGTTGCATTTTACTTTCCAATCCCATTG
AAAATAGGAACTTTTATTTGGACTTTTGCAATGGCCTTTTTGATGAAGCATATATCTTTA
AAATTTAGAATATGTGGATTCATTGCTATTTAAGGAGTTTTAATGATGCTCTTACCTATA
ATTGCAAATTATATGTAGACCAATTTAGGTTACGCTTTAATGATAACTATTTGCTTTCTA
GTCGGATCAACTGCATGTATTGTTCAAAATTCAAACCTCGCTCTTGTCTCAAATTTTGAT
AAGCTAAGCTTGAGTAAATAAACATTTTTCAAAATTAAAATTTCTTTTATATTTAAATTT
ACCTTTTTATTAATAGAACTATATTGGGTATTTACTTCTATAACTCAATTGATTATGAAT
CTATGCAGAGCTATCATTCTTGTAATTTTTGGTGACAATTAGGAAGGTATTAATACAGGA
ATATTTGTTTATTATGCAGTTGCTGATCTTGTGATGATAATAACTATAATTTCAGTTATA
AAATTCCTAAAAACATCATTTTATCTGGATATGCTTGAAATAAATAAATTACAATTATAA
AACGAAAGCGAAAACACTGATGATGAAAACCAAGTATAATAATAAGAATCGATTTCTAAT
CTATCTTCTAGCTAAATTTAACATCAAGCTGAGTAGTCTTTGCTCTAAAAATAAAATAAA
ATTTAAATGGCTAAAAATTGTTTCATGAAAGTGAAATTCATTTGTTTTTCAATTTTATTG
ACTTACATTATTTAATACATGCTTTTCCCAGGAGTGGCTGTTTTCTAAAAATAATATCAT
ATGATTCATTCTAAAGCTTGGGCTACGTAAATAAATATTTTTATTCAAATAACCTTTCTA
ATAATAAATTTATTAAATTAGTTTGAGCATGCAAATAGTTTACAGTGTTGGAGACTTAGT
TGGAAAGTATCTGAGTACATTTAATTTTTATAATACTACCGCTCTCTATGCGATATCCTT
AAGCAGATTATTCTTATTCTTTACATTTTTAATGATTGCTCATGATTATGAATCTTCCTT
CTTTTAGAATGACATATTTGCCTTCATTAATATATTTAGCTTAAGTTTTACTAATGGATT
TGTTACAGGAGGGTTTATGACAATTGGTCCTCAAAGAGGTTCTAATAACTAAGAAAGAAG
CTTAATATCAATAATCTAAACTTTCTTCTTGACATTTGGAATTTCTGTAGGCACATTTTT
AGCTCTTACACTAAAATTTTGA


>TTHERM_00463710(protein)
MKQKISDIAKHTPLTKITFALLGTNTLLGWSAVLTSFDYFSDKFPQDEFPDVAFYFPIPL
KIGTFIWTFAMAFLMKHISLKFRICGFIAIQGVLMMLLPIIANYMQTNLGYALMITICFL
VGSTACIVQNSNLALVSNFDKLSLKLYWVFTSITQLIMNLCRAIILVIFGDNQEGINTGI
FVYYAVADLVMIITIISVIKFLKTSFYLDMLEINKLQLQNESENTDDENQVQQQESISNL
SSSQIQHQAEQSLLQKQNKIQMAKNCFMKVKFICFSILLTYIIQYMLFPGVAVFQKQYHM
IHSKAWATLSMQIVYSVGDLVGKYLSTFNFYNTTALYAISLSRLFLFFTFLMIAHDYESS
FFQNDIFAFINIFSLSFTNGFVTGGFMTIGPQRGSNNQERSLISIIQTFFLTFGISVGTF
LALTLKF