Identifiers and Description

Gene Model Identifier

TTHERM_00469100

Standard Name

RPT4 (26S proteasome regulatory subunit T4)

Aliases

PreTt18712 | 55.m00267 | 3710.m00115

Description

RPT4 26S proteasome regulatory ATPase subunit 10B

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00004 ) ATPase, AAA family
  • ( PF00158 ) Sigma-54 interaction domain
  • ( PF07724 ) ATPase family associated with various
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various
  • ( TIGR00382 ) ATP-dependent Clp protease, ATP-binding subunit
  • ( TIGR00635 ) Holliday junction DNA helicase RuvB
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( TIGR01552 ) prevent-host-death family protein
  • ( TIGR02881 ) stage V sporulation protein K
  • ( TIGR02902 ) ATP-dependent protease LonB

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_35537 0
Description: None
WormBase WBGene00004504 9.997093137033517e-262
Description: locus:rpt-4 Probable 26S protease regulatory subunit 10B status:Confirmed UniProt:O17071 protein_id:CCD62358.1
Tetrahymena borealis EI9_15684.1 9.997093137033517e-262
Description: 26S proteasome subunit P45 family protein (391 aa)
Oxytricha Contig10954.0.g62 9.997093137033517e-262
Description: ATPase family associated with various cellular activities (AAA)
SGD YOR259C 8.000959403653794e-177
Description: RPT4 One of six ATPases of the 19S regulatory particle of the 26S proteasome involved in degradation of ubiquitinated substrates; contributes preferentially to ERAD; required for spindle pole body duplication; mainly nuclear localization
DictyBase DDB_G0284517 4.997692805068281e-176
Description: psmC6 on chromosome: 4 position 2090141 to 2091556

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00469100(coding)
ATGGCTTCAACTGATAATCCAGTAGTTTAAAATTACCTTAGAGTTAAGCGTGAACATGAG
AAGATGGAAATCGATTTAAAAAAGCAAAGATTCAACTTACGTGACTTGAATAAGCAATTA
GATAAAACTGATGATTAGCTTAAGGCTATCTAAAGTGTAGGATAACCAATTGGTGAAGTT
TTAAAGCAAATTAATGAAGAAAAATACATTGTTAAATCATCAAGTGGCCCTAGATACGTA
GTTGGTGTTAAATCTAAAATTAATAGAGAAAAGCTTGTTATTGGAGCTAGAGTAGCATTA
GATTAGAATACTTATACTATTGTTAGAATCTTGCCTAGAGAAGTAGATCCTATGGTATAT
CATATGTTACATGAAGATCCAGGTAAAGTTACCTTTGACGATGTCGGTGGTTTAGATGAC
TAAATTAGAACTCTTAGAGAAACTATTGAGTTACCAATCACAAATCCAGAATTGTTTAGA
AGAGTAGGTGTTAAGCCTCCTAAAGGTTGTTTGATGTATGGACCTCCTGGTACTGGTAAA
ACTTTAATTGCAAGAGCTCTTGCCAATAATGTTGATGCAAAATTCTTAAAGGTTGTAGCA
TCAGGTATAGTAGATAAATATATTGGTGAATCTGCAAGAGTTATTCGTGAAATGTTCGCT
TTTGCAAGAGAGCACGAACCATGCATTATATTTATGGATGAAATCGATGCTATTGGTGGT
CGTAGATTTTCAGAAGGTTCTTCTGCTGATAGAGAAATCCAAAGAACTTTGATGGAACTT
CTAAATCAAATTGATGGTTTTGATGATTTAAAGAGAGTCAAGATTGTTATGGCCACAAAT
AGACCCGATGTGCTTGATCCTGCACTTATGAGACCAGGTCGTTTAGATAGAAAAGTAGAA
ATTCCCTTACCTAATGAATAGGCCCGTGCAAAAATTTTAGGCATTCATATGAAAACTATT
ACTATATTAGGTGAAGTAACTTATATTGAAGAACTTGCCAAGCTTACAGAAGATTTCAAT
GGAGCTGATTTACGTAACGTATGTACAGAAGCAGGTATGTTTGCTATTAGAGCTGGTAGA
GATTATGTCATTTAAGAAGATTTCTTCAAGGCTGCTAGAAAGATAAAAGAATCTAAAAAA
TTAGAATCTAAGTTAGATTACAGCAAAGTTTGA


>TTHERM_00469100(gene)
ATGGCTTCAACTGATAATCCAGTAGTTTAAAATTACCTTAGAGTTAAGCGTGAACATGAG
AAGATGGAAATCGATTTAAAAAAGCGTAATAATTCTAATTTTATTTATTTAAGTTCAAAG
GCACTTTATTCAATCATTACATATTAAGATTGCTTAATTAATCAATATTGATTAAGACTT
CAAATGAGTGATTTATTAAATATAAAAAATTATTTTTATAAATGAATATAGAAAGATTCA
ACTTACGTGACTTGAATAAGCAATTAGATAAAACTGATGATTAGCTTAAGGCTATCTAAA
GTGTAGGATAACCAATTGGTGAAGTTTTAAAGCAAATTAATGAAGAAAAATGTAAATCTT
TATTAGTTTTGTTTCTTTATGGCAGATCAAAAAAGGTTATGTGACAATAATTTTAAACAA
ATATGAGTGACTGGCCTTTTTTCCTTCATTTTGATGAGCTATTATCCTTAAAATTATATA
AACATATTATTTTATTTATAGACATTGTTAAATCATCAAGTGGCCCTAGATACGTAGTTG
GTGTTAAATCTAAAATTAATAGAGAAAAGCTTGTTATTGGTAAAGAATCAATTTTTTGAA
TTTAAAATATTTTGTTAAGTTAGTTGATGGCTCCTTATTAACAAATATTATTGTTGTTTA
TTATTATAGGAGCTAGAGTAGCATTAGATTAGAATACTTATACTATTGTTAGAATCTTGC
CTAGAGAAGTAGATCCTATGGTATATCATATGTTACATGAAGATCCAGGTAAAGTTACCT
TTGACGATGTCGGTGGTTTAGATGACTAAATTAGAACTCTTAGAGAAGTAATTTATATAT
TTATTTCTATTAATAGAGTTTTTAGTATGCCTCATTTAATAATAAATAAATAATTAAATA
GTTTAACCATTTTAAGCTTTAGCATTTTATTACACACTTACTTAATTAGGAAATAAATAA
CTCCAAACAAATTTTAATGGAAGAAGAAAAATAGATTATTTATTTATAATTAGAATGCTT
ATTAAAATTTCAATAAAATAATAATAATTAAAATTTATTAATTAGACTATTGAGTTACCA
ATCACAAATCCAGAATTGTTTAGAAGAGTAGGTGTTAAGCCTCCTAAAGTAATATTTAGT
TAAAATAAGTTATGAGTCCTAATTAAATTATTCTTATTAGGGTTGTTTGATGTATGGACC
TCCTGGTACTGGTAAAACTTTAATTGCAAGAGCTCTTGCCAATAATGTTGATGCAAAATT
CTTAAAGGTTGTAGCATCAGGTATAGTAGATAAATATATTGGTGAATCTGCAAGAGTTAT
TCGTGAAATGTTCGCTTTTGCAAGAGAGCACGAACCATGCATTATATTTATGGATGAAAT
CGATGCTATTGGTGGTCGTAGATTTTCAGAAGGTTCTTCTGCTGATAGAGAAATCCAAAG
AACTTTGATGGAAGTAAAAAAAAATTCATTGTTTAAAATTAGAAATTTAATTTAATAAAA
TTAATTTAAAAAAATAGCTTCTAAATCAAATTGATGGTTTTGATGATTTAAAGAGAGTCA
AGATTGTTATGGCCACAAATAGACCCGATGTGCTTGATCCTGCACTTATGAGACCAGGTC
GTTTAGATAGAAAAGTAGAAATTCCCTTACCTAATGAATAGGCCCGTGCAAAAATTTTAG
GCATTCATATGAAAACTATTACTATATTAGGTGAAGTAACTTATATTGAAGAACTTGCCA
AGCTTACAGAAGATTTCAATGGAGCTGATTTACGTAACGTATGTACAGAAGCAGGTAAAA
TAAAAATAATAAATGATAAACCTAGTTTAAAATGAATATTATTGAAATAAAAATATAGGT
ATGTTTGCTATTAGAGCTGGTAGAGATTATGTCATTTAAGAAGATTTCTTCAAGGCTGCT
AGAAAGATAAAAGAATCTAAAAAATTAGAATCTAAGTTAGATTACAGCAAAGTTTGA


>TTHERM_00469100(protein)
MASTDNPVVQNYLRVKREHEKMEIDLKKQRFNLRDLNKQLDKTDDQLKAIQSVGQPIGEV
LKQINEEKYIVKSSSGPRYVVGVKSKINREKLVIGARVALDQNTYTIVRILPREVDPMVY
HMLHEDPGKVTFDDVGGLDDQIRTLRETIELPITNPELFRRVGVKPPKGCLMYGPPGTGK
TLIARALANNVDAKFLKVVASGIVDKYIGESARVIREMFAFAREHEPCIIFMDEIDAIGG
RRFSEGSSADREIQRTLMELLNQIDGFDDLKRVKIVMATNRPDVLDPALMRPGRLDRKVE
IPLPNEQARAKILGIHMKTITILGEVTYIEELAKLTEDFNGADLRNVCTEAGMFAIRAGR
DYVIQEDFFKAARKIKESKKLESKLDYSKV