Identifiers and Description

Gene Model Identifier

TTHERM_00469230

Standard Name

MPK1 (Mitogen-activated Protein Kinase )

Aliases

PreTt18725 | 55.m00280 | 3710.m00128

Description

MPK1 cyclin-dependent kinase-like Serine/Threonine kinase family protein; Putative ERK1/2 subfamily mitogen-activated protein (MAP) kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_13752 0
Description: None
Tetrahymena borealis EI9_15672.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (758 aa)
Oxytricha Contig19712.0.g79 9.997093137033517e-262
Description: Protein kinase domain
DictyBase DDB_G0286353 2.9995941501461703e-129
Description: erkA on chromosome: 4 position 4355028 to 4356796
SGD YBL016W 5.0008352594020174e-107
Description: FUS3 Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its degradation
WormBase WBGene00003401 3.001222955304439e-106
Description: locus:mpk-1 Mitogen-activated protein kinase mpk-1 status:Confirmed UniProt:P39745 protein_id:CAA87057.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00469230(coding)
ATGCAGCAATAATAATTATAGAATTAATATAATCACGTTAAGTAGATGTAGTAATAATAA
AATTAGCAATAACAAGCACAATAGTAATAGCTGTAACAACAATAGTAGCAATAGTAGTAG
CATTAGTAGGCACAACAGCACCAAGAAAAGCCTCAAAAACCAATTCAAGTACCTCCTGGT
AAGCACAAATTTGATTGTGGGCAGACTATTTTTGTTGTCGATGAGAAATATGAATATATA
AAATAGATCGGATATGGAGCTTACGGTGTGGTTTGCTCAGCAGTAAATAAAGAAAATGGT
TCAAAAGTTGCAATTAAAAAGGTTTAAAATGCTTATGATGATTTGATCGATGCAAAGCGT
ATTGTCAGAGAAATCAAACTTTTAAAATTCTTTGAACACGATAATATTATTTCACTTTTA
GATGTTATTAAGCCTAACGCGCCAGTAGGTGACGAAGATATCTACATGGTATTTGATTTG
ATGGAAACTGATTTGCACCGTGTTATTTATTCTCGTTAAGAACTCAGCGATGAGCATATC
TAATATTTTGTCTATTAAATTCTTCGTGGTCTCTTATACATTCATTCTGCAAATGTTATT
CATCGTGATCTAAAGCCCAGCAATATTTTGCTTAATAAGAACTGTGATCTTAAAATTTGC
GATTTTGGTCTGGCCCGTGGATTCGAAGAGCCTGGTGAAAGCTTGACTGAATACGTAATT
ACTCGTTGGTACCGTGCTCCTGAAGTTATTTTGAATGCTAGTGAGTACAATCAAGCTGTT
GATATTTGGTCAGTTGGTTGCATCACTGCTGAATTATTAGGAAGAACACCCCTTTTCCCA
GGAGAAAATTATCTAGATTAAGTTTAGCGTGTCATAGCAGTTTTAGGAACCCCTACTCAA
GAAGATATGGCTTATATTGGCAATTAAGATGCTATTAAATATATAAAATCTCAACCAAAA
AGAACTAAATAATCATGGTAGAGTCTTTATCCGAAAGCAAATCCACTAGCTCTTGACCTT
TTAAGTAAAATGCTCACTTTCAATCCAGAAAAACGCTATACTGTTAAAGAATGCATCGAA
CATCCTTACTTCGAAGGACTTCATTACCCTGATGAAGAACCTGAGTGTGAGTAACTTGAA
ACATTTATGAAAATTAAGAAGAAAAACAAATTCAAATTCAAAGATTAATAAAAGGAGATA
AATAGATACAAATAATCAAGCAAATAAATAAATAATCAAGCAAATAAGCAAAAGCAAGCA
AGCAAACAAGCAAACATTTATTTATTATTACTATTGTAGTTTTTTAAATTTAGAATTTTT
TCAAACAAGAAGTAATAGTAATTTAAAAAATATAAAATACATTCTCTAAAATCATAGCTT
GACGCTTCATTTATCAACATAACGATTAAAAAAAGGTATGTCATCATAATTTAAAAAAGA
GTACAAATTATTTATGTTATTACTTAAATCCAATATAATAAATAAATATCTCCTTTTATT
TCTTAAACAGTAAAGAAATGTTAATCAAAACGTATAAATATATTTATATATATATATAGT
TATATAGATAGTAAGTTAGATAATCACTTTGTCTTATAATCTAGGCTTCATTTAATATTA
GCACCAAAAATCAATTAGACATTAACTTATTATAATATTTTTGTATAAATATTTTCGACT
TTGAAATTTTAGTTATTTTTAATTTATTTAAACTCTAATTTACTATTTTTTTTTGAAATA
TTTATGACATAAAAAAAAACATGA


>TTHERM_00469230(gene)
ATGCAGCAATAATAATTATAGAATTAATATAATCACGTTAAGTAGATGTAGTAATAATAA
AATTAGCAATAACAAGCACAATAGTAATAGCTGTAACAACAATAGTAGCAATAGTAGTAG
CATTAGTAGGCACAACAGCACCAAGAAAAGCCTCAAAAACCAATTCAAGTACCTCCTGGT
AAGCACAAATTTGATTGTGGGCAGACTATTTTTGTTGTCGATGAGAAATATGAATATATA
AAATAGATCGGATATGGAGCTTACGGTGTGGTTTGCTCAGCAGTAAATAAAGAAAATGGT
TCAAAAGTTGCAATTAAAAAGGTTTAAAATGCTTATGATGATTTGATCGATGCAAAGCGT
ATTGTCAGAGAAATCAAACTTTTAAAATTCTTTGAACACGATAATATTATTTCACTTTTA
GATGTTATTAAGCCTAACGCGCCAGTAGGTGACGAAGATATCTACATGGTATTTGATTTG
ATGGAAACTGATTTGCACCGTGTTATTTATTCTCGTTAAGAACTCAGCGATGAGCATATC
TAATATTTTGTCTATTAAATTCTTCGTGGTCTCTTATACATTCATTCTGCAAATGTTATT
CATCGTGATCTAAAGCCCAGCAATATTTTGCTTAATAAGAACTGTGATCTTAAAATTTGC
GATTTTGGTCTGGCCCGTGGATTCGAAGAGCCTGGTGAAAGCTTGACTGAATACGTAATT
ACTCGTTGGTACCGTGCTCCTGAAGTTATTTTGAATGCTAGTGAGTACAATCAAGCTGTT
GATATTTGGTCAGTTGGTTGCATCACTGCTGAATTATTAGGAAGAACACCCCTTTTCCCA
GGAGAAAATTATCTAGATTAAGTTTAGCGTGTCATAGCAGTTTTAGGAACCCCTACTCAA
GAAGATATGGCTTATATTGGCAATTAAGATGCTATTAAATATATAAAATCTCAACCAAAA
AGAACTAAATAATCATGGTAGAGTCTTTATCCGAAAGCAAATCCACTAGCTCTTGACCTT
TTAAGTAAAATGCTCACTTTCAATCCAGAAAAACGCTATACTGTTAAAGAATGCATCGAA
CATCCTTACTTCGAAGGACTTCATTACCCTGATGAAGAACCTGAGTGTGAGTAAGTTTTT
GATTGGTCTTGGGATAAATTCACACCTACTAAAGAAATATTGTAGAAGATGATCTACTAA
GAAGCTAAATCTTTCCATCCTATTCACTGAAATGCAGGATTACTTTGTACAATCATTATA
AATTTTTAATATTAAAATACTAAATAATAATCATATTCAACCATTCATAAATTTTAAATC
ATTGTAAGCTTTATTCATACTTTAATTCTATAAATAGCTTGAAACATTTATGAAAATTAA
GAAGAAAAACAAATTCAAATTCAAAGATTAATAAAAGGAGATAAATAGATACAAATAATC
AAGCAAATAAATAAATAATCAAGCAAATAAGCAAAAGCAAGCAAGCAAACAAGCAAACAT
TTATTTATTATTACTATTGTAGTTTTTTAAATTTAGAATTTTTTCAAACAAGAAGTAATA
GTAATTTAAAAAATATAAAATACATTCTCTAAAATCATAGCTTGACGCTTCATTTATCAA
CATAACGATTAAAAAAAGGTATGTCATCATAATTTAAAAAAGAGTACAAATTATTTATGT
TATTACTTAAATCCAATATAATAAATAAATATCTCCTTTTATTTCTTAAACAGTAAAGAA
ATGTTAATCAAAACGTATAAATATATTTATATATATATATAGTTATATAGATAGTAAGTT
AGATAATCACTTTGTCTTATAATCTAGGCTTCATTTAATATTAGCACCAAAAATCAATTA
GACATTAACTTATTATAATATTTTTGTATAAATATTTTCGACTTTGAAATTTTAGTTATT
TTTAATTTATTTAAACTCTAATTTACTATTTTTTTTTGAAATATTTATGACATAAAAAAA
AACATGA


>TTHERM_00469230(protein)
MQQQQLQNQYNHVKQMQQQQNQQQQAQQQQLQQQQQQQQQHQQAQQHQEKPQKPIQVPPG
KHKFDCGQTIFVVDEKYEYIKQIGYGAYGVVCSAVNKENGSKVAIKKVQNAYDDLIDAKR
IVREIKLLKFFEHDNIISLLDVIKPNAPVGDEDIYMVFDLMETDLHRVIYSRQELSDEHI
QYFVYQILRGLLYIHSANVIHRDLKPSNILLNKNCDLKICDFGLARGFEEPGESLTEYVI
TRWYRAPEVILNASEYNQAVDIWSVGCITAELLGRTPLFPGENYLDQVQRVIAVLGTPTQ
EDMAYIGNQDAIKYIKSQPKRTKQSWQSLYPKANPLALDLLSKMLTFNPEKRYTVKECIE
HPYFEGLHYPDEEPECEQLETFMKIKKKNKFKFKDQQKEINRYKQSSKQINNQANKQKQA
SKQANIYLLLLLQFFKFRIFSNKKQQQFKKYKIHSLKSQLDASFINITIKKRYVIIIQKR
VQIIYVITQIQYNKQISPFISQTVKKCQSKRINIFIYIYSYIDSKLDNHFVLQSRLHLIL
APKINQTLTYYNIFVQIFSTLKFQLFLIYLNSNLLFFFEIFMTQKKT