Identifiers and Description

Gene Model Identifier

TTHERM_00470810

Standard Name

RAB7 (RAB GTPase 7)

Aliases

56.m00199 | PreTt22495 | 3686.m00042

Description

RAB7 small guanosine triphosphatase family (GTPase)-like Ras family protein; Putative Rab GTPase; putative member of the evolutionarily conserved Rab ramily which functions in regulation of membrane trafficking

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF01926 ) GTPase of unknown function
  • ( PF03029 ) Conserved hypothetical ATP binding protein
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR02528 ) ethanolamine utilization protein, EutP

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11358.1 5.001524836186341e-138
Description: Ras family protein (210 aa)
WormBase WBGene00004271 4.9994004612166366e-86
Description: locus:rab-7 status:Confirmed UniProt:Q23146 protein_id:CAA91357.1
DictyBase DDB_G0269236 4.001073573587828e-83
Description: rab7A on chromosome: 1 position 2627248 to 2628493
Oxytricha Contig15386.0.g21 1.0004671766404936e-76
Description: Ras family
SGD YML001W 6.99980278126514e-75
Description: YPT7 Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion, similar to mammalian Rab7
Stentor Coeruleus SteCoe_33141 5.5210822770285325e-42
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11387043: Stenmark H and Olkkonen VM (2001) The Rab GTPase family. Genome Biol 2(5):REVIEWS3007
  2. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00470810(coding)
ATGAGCACAAATAAAAGAAAGCAACTCTACAAGATTATCATCTTAGGTGATTCTGGGTAC
GTCAACTAGCGTTTTACTCAACAATATAGAGCTACAGTTGGTGCTGATTTCATGGCTAAG
GAAGTCACTATTGATGATCGTATGGTTACATTACAAATTTGGGATACCGCTGGTCAAGAA
CGTTTCTAATCCCTCGGTGGTGCTTTCTATAGAGGTGCTGACTGCTGTGTTTTGGTCTAT
GATATTACAAATAAGAAGACCTTTGAAAACTTAGAAAGTTGGAAAGAAGAATTTAAGCAA
CAAGGTTGCCCTAAAGATCCTGACACTTTCCCATTTGTTGTTATTGGAAATAAAAGCGAT
AAAGCATCAGAAAGAAAAGTTGAAACTGAGTTTGCTCAATAATGGTGCAAATCTAATGGA
GACATTAAGCACTTCGAAACATCTGCCAAGGATGATACTAATGTTAATGCTGCTTTTATG
GCTATTGCTAAGGCTGCCTCCTCTTAATTCTAAGAAGATGCCATCTTCTTCCCACCAAAG
CCTGTTGTTTTGTAAACTGATAAGGCCAAAAAGAAAGAAAAAAAGGATGACTGCCCTTGT
TGA


>TTHERM_00470810(gene)
ATGAGCACAAATAAAAGAAAGCAACTCTACAAGATTATCATCTTAGGTGATTCTGGGTAA
ATGATCCATACTAATTCTTAATTGCAGCGATTGACATTTTTAATTATATTTCAGGATTAT
GTGCTATTTTATCAGCATAATAAGCTTGAAAATTGTGATTGTGCAGAAATTCATCTATTA
ATTTTTTTAACCCATTTTTATTAAAATAAATAGTGTAGGAAAGACTTCTCTTATGAACCA
GTAAAATGTTTTTACAGTTATTAGCATTAAAATAAATAGTTGGGCTGTTAAATAGTCTAA
AGATCAGAATAGCAGAAATTTATTTTTTTTTTTGTTTTATTACAGGTACGTCAACTAGCG
TTTTACTCAACAATATAGAGCTACAGTTGGTGCTGATTTCATGGCTAAGGAAGTCACTAT
TGATGATCGTATGGTTACATTACAAGTAATTAATATAACAAATTTTCAGTTATTTATTAA
GTTCTAGTCCAAGAATTATTTTGCCCATATGATAGAATTGTTATTTTATCTATAAAGCAG
CATTCATTTTTGCAGCAAATCTTAAATATAACTACATCATTGTTATTGATTAGTCATTAA
TAAAATTTTTAATTTTTGATAAAAATAAATATTCGTTTATAATTATTAGATTTGGGATAC
CGCTGGTCAAGAACGTTTCTAATCCCTCGGTGGTGCTTTCTATAGAGGTGCTGACTGCTG
TGTTTTGGTCTATGATATTACAAATAAGAAGGTAATTAAATAAATATTTTATGCATAAAA
TAAAGTTAGCAGAATTATAATTTGTTATCTGAAGATCTTACTTGAAGATAAATATTTACA
AATTAGCACAAGTTTTCAAATATTTTTAAATCAACATTTTTTTTATAAAAATTATTTAGA
CCTTTGAAAACTTAGAAAGTTGGAAAGAAGAATTTAAGCAACAAGGTTGCCCTAAAGATC
CTGACACTTTCCCATTTGTTGTTATTGGAAATAAAAGCGATAAAGCATCAGAAAGAAAAG
TTGAAACTGAGTTTGCTCAATAATGGTGCAAATCTAATGGAGACATTAAGCACTTCGAAA
CATCTGCCAAGGATGATACTAATGTTAATGCTGCTTTTATGGCTATTGCTAAGGCTGCCT
CCTCTTAATTCTAAGAAGATGCCATGTAATTTTACTAGAATTTAATTATTTTAGCTTGTT
CAATAGTAATGAGAAAATCAATATAAATTCACTCAATAAGTTTACATTAAATGGAGTTCA
TAATATGAAATATATAAATAAATGAATAAATGAGTATTGATTTCATCATCTAAAAAACGA
AATTTATACACAATTAAAAACAATAAATTAATACCCTATGAATAAAATATTTAACTTTAA
TCTTTAATTATTAAAAGCTTCTTCCCACCAAAGCCTGTTGTTTTGTAAACTGATAAGGCC
AAAAAGAAAGAAAAAAAGGATGACTGCCCTTGTTGA


>TTHERM_00470810(protein)
MSTNKRKQLYKIIILGDSGYVNQRFTQQYRATVGADFMAKEVTIDDRMVTLQIWDTAGQE
RFQSLGGAFYRGADCCVLVYDITNKKTFENLESWKEEFKQQGCPKDPDTFPFVVIGNKSD
KASERKVETEFAQQWCKSNGDIKHFETSAKDDTNVNAAFMAIAKAASSQFQEDAIFFPPK
PVVLQTDKAKKKEKKDDCPC