Identifiers and Description

Gene Model Identifier

TTHERM_00470890

Standard Name

PLK5 (Polo-Like Kinase)

Aliases

PreTt22503 | 56.m00207 | 3686.m00050

Description

PLK5 Serine/Threonine kinase domain protein; Polo-like kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11350.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (993 aa)
Oxytricha Contig16191.0.g79 3.999498296699862e-96
Description: Protein kinase domain
DictyBase DDB_G0274503 9.998074580622396e-81
Description: plk on chromosome: 2 position 4379150 to 4382891
WormBase WBGene00004043 5.000518477595783e-71
Description: locus:plk-2 Serine/threonine-protein kinase plk-2 status:Confirmed UniProt:Q9N2L7 protein_id:CCD70415.1
SGD YMR001C 9.997863464222902e-69
Description: CDC5 Polo-like kinase with multiple functions in mitosis and cytokinesis through substrate phosphorylation, also functions in adaptation to DNA damage during meiosis; has similarity to Xenopus Plx1 and S. pombe Plo1p; possible Cdc28p substrate
Stentor Coeruleus SteCoe_22413 1.0112214926104486e-43
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00470890(coding)
ATGAGCACAGAGAATCAAAATTAGCAATAAAAACCTGCGCAGGATCCAGTTTCGTGCTAC
CAAGCGTAGCCCTAAAGAAATTTATTGCATGAAAAAAGAAAAAATTAAGATGGCGAATGG
AAAGTAGAGAGATCTTATGAAGTACTAAGCAAATTAGGCAAAGGAGGATTTGCTAAAGTC
TACCTTGCAAAAGATATTTCATCAAATGAGTAATATGCAATAAAGGTAGTTGACAAATCC
TCATTAGAAAAGGATTCCTTCAAAGAAAAGTTGAACTAAGAAATAAAGATTTAGAAAAGT
CTAAACCATGAAAATGTAGTTAAATATTACACTTCTTTCGAGGATTCCTAGAATGTTTAT
ATAGTACTTGAGTATTGCAGCAATTAGACTTTTAAGGAGCTACTGGACAGAAGAAAAAGA
TTAACTGAAATCGAAGTCAAGAGCCATCTTTTTCAAATAATCTAATCCCTCAAATATATC
CATTCGAAAGGAGTTATTCATAGAGATTTAAAGATAGCAAACATATTTTTAAATGACAAG
ATGGTAGTCAAATTAGCAGACTTTGGTTTATCAGCTATGATGAAGAATGCTCAAAAAAGA
AAAACTGTTTGCGGGACTCCAAATTATATAGCTCCTGAAGTTCTTAAAAATCAAGGTCAT
GATTACTTAGTTGATAACTGGGCCATTGGAGTGATAGTTTATACATTTTTAATCGGTAAG
CCACCATTCGAAGAAAAAGAAGTTGAAAATACTCTGAGAAACATCAAGGCCAACAGATAT
TCTTTCCCTGAAAATTGTACAATTTCAAAAGAAGCAAAAGATTTTATTTAAAAAATCTTG
GTTCCTAATCCAGACTAGAGATTAACTATGGATTAAATGCTTCAACATCCATTTATGAAA
AGTGAAGAGTATTATATTCCTAAAACATTCCCAATAAGCACCTTAGCACTTCCTCCTACT
GCTAACTATTTAAGAAAATTACGCAAAAGCGAGTCTGTTCTAGCTCCGAAATCTTAATTA
TAATTAGCAAATAATGGAGCTCAGCCTTATGATTATAATTGCCAGAATGAAAACTAAACA
CCTCATATATCAACAACCCAATCCACAAAGCATTTTTAGCGTAGTAATCACTTCTACTAA
ACCCAAAGCAGCAGTACTGCTAACTTTAAACCTACTTCACTATCTCAGCAGCATGCTACT
ACAAATTCTAATAACTTATAGGACACTAATTCTACTAATACAAACGAAAATAATACAATA
AGCAGTAACAACCCTAATAATAATGAGATAAACATAGCTAACTAAGAAAATGACAATTAT
CAATTATTGCGCATGAGAAGCTAAGAAAATATTCAATTTTCTCGTTAATTCTAAAATTAC
TTCTAAGGTAAAAAAGAAAACTCTCTCCAAAAGTACCCAAGCAGTTAATAATTTACTGGA
AATCCAATCTCATCTAATTAAAATATACTTAATTAGCACTAAAGTCCTCCAAAAAATTTA
AATACAGCTGCTGGATATTCCTCTGTAGAGAAGCCAAGTTACTCCCAAAGCTCTTAAACA
AAAGTCCCAACCCTTACTTCTTCTTAAAAATTCGATATCAAAAAATATAATACTATTCAC
ATTTCTGACACAAATTAAAATTAAAATCATAACAAAGCCAATAATCCTTATTACAATCTT
CCTGCATAAAGTGGTTAGCAAAACTCAAATTAGTCACCTTTAGAGTAAATAAATCTTCTG
ACTCAAAAGTAAAATATTTATTTATTCGATTACATTGACTGCAGCAGCAAATTTGGTCTG
GCATACTACTTGAATAACGGAAACGTAGGTATCTTACTGAATGATGGAAATGTAACCTAA
ATCGTTGATGAAACGTTTGAGCACATCTAAAAAGTTTAAGACAACTATGTTATTCAAAAG
TATCCTATTAAATAGATACCTCCCTCATGCTAAAACTTGTTTAGACTGACCACAAATATA
AAAGAATACTTCCTCAACAAATACAAACTTATTTGTCCGAAAGTTGAATTGTAAGAAGGA
GATTTTGAAAAAGAAGTCTATCTGAAAAAGTTCATTTCAACTAAATAAGCTTCCTTTTTT
AGATTTAGTAACAAAGATCTTTAAGTTATTTTTATTGATAAGAGTGAAGTTGTTATCACT
TAGCAAAATAAAAATCTATACTTCAAAGATAAGAATGGAACTCAAAAAATTCACACATTA
AACCATGAAGATAAGTCTTCGTTACCTCATAATATTAGAAAAAGAATATTGTATATTAAA
GATGTTTTCCTAAGTGGTAATCACTCAAAGACACAATAAGCTAACAAGCTACAAGGAACT
GATAACTAATAAAATAGTGGCTAAAACCCTACAAAATACTCTTCAACTACTCCTAGCAGT
AATAATTAAGTTTAACCTTCCTCTGTCCCTTGCTCTCCCCCAATCTCATCTTTAACTCAT
TCATCAAGTTAAAACTAAAAATTAACGCAAGCTGCTAATAATATTGTTAACCCTGCATAG
CAAATGTCGGCATCATCCTTAACTTAGTATTAATCTGTACCACTTTAAAATGGTTAAAAT
TAAGCATCTATGTTCAATTCTACTTACCAATAAGGTTTTAATTAAAATAATCCTTAGTCA
TCTTCATTATCCCCTTTAAATTCTATCAATTAAAATATATCTCCAGTTTAGTAAGACCCT
AACAATAATATTAGCAACAATCTCCAAAACAATATATAATTCAGCTAAATAATGAAAACA
AACAATAACACTACCTCTTCTACTAACAACTCTGTATCAACATCATAATAAACTCCATAA
TAATAAGTGCTTAACCAAATTAAATACAATAATAGTTAACAACTCTCTTAAACTGCAAAA
CTATCACTTTACTAGTCTTAAAAGTTAAGAGTTTCTGTTGAAAATTATCAATCTCCTGTC
TCAAAGCCTGTTTAAAACGCTCCTTCAGTCTATCCTCTTAAAATGTATTAATGA


>TTHERM_00470890(gene)
ATGAGCACAGAGAATCAAAATTAGCAATAAAAACCTGCGCAGGATCCAGTTTCGTGCTAC
CAAGCGTAGCCCTAAAGAAATTTATTGCATGAAAAAAGAAAAAATTAAGATGGCGAATGG
AAAGTAGAGAGATCTTATGAAGTACTAAGCAAATTAGGCAAAGGAGGATTTGCTAAAGTC
TACCTTGCAAAAGATATTTCATCAAATGAGTAATATGCAATAAAGGTAGTTGACAAATCC
TCATTAGAAAAGGATTCCTTCAAAGAAAAGGTAACATATAAAAATTTAAGACATATGAGC
TGGATTTTTAATAATATTTTGACATAGCACAGAGCTTTATTAAATTTTTAATATTAACTG
GGCTATTAATTTTTTTTATGTATGATCAATTAGAATAGATTTTAATCAATTTTAAAATAA
AACTATAGTTGAACTAAGAAATAAAGATTTAGAAAAGTCTAAACCATGAAAATGTAGTTA
AATATTACACTTCTTTCGAGGATTCCTAGAATGTTTATATAGTACTTGAGTATTGCAGCA
ATTAGGTAATTAATAATAAATAGTTTTCTATTTAAAAATAATGCAAAATTAATATCTATA
AATATCATACGATCAATCAATCTATTACTACTTAAATGTATTAATTCAATTTATTCTTAA
TTATATTAAAAAAAGACTTTTAAGGAGCTACTGGACAGAAGAAAAAGATTAACTGAAATC
GAAGTCAAGAGCCATCTTTTTCAAATAATCTAATCCCTCAAATATATCCATTCGAAAGGA
GTTATTCATAGAGAGTAAATAAATTCAACATTTATTTTTGTTTTTTACTTCTTTAACTAT
ATTTCATTTAATATCAAAACAATATTCCGCAAAATTTTAACAGCTAACTATTCAAATTTC
TTAGAGTGAATTTAGATATTTTTGAATGAATAGAGATAAATATTAAATAACTGAATAAGA
AATAAATAACTTAGTTTATATTCCACATTTTATAACACCCTTTTTAATTAAATAATTAGT
TTAAAGATAGCAAACATATTTTTAAATGACAAGATGGTAGTCAAATTAGCAGACTTTGGT
TTATCAGCTATGATGAAGAATGCTCAAAAAAGAAAGTAATTAATCTATTTATTTATTTAC
ATATATATTTATTAACTCATTGATTAATGCATTCTCTTTTAAATTTAATAGTGGTTTTAT
TAGTTTGTTTCCTTTTACTATTAAAATACAAAAATTTAATTTTCTAAGCTAATCCATTCA
AACATATTTTACATATTTTAGTTTAATTAATTATTTTCTTTAAACGAATCAAATAATTAA
CAAAACAAATTATTCAAATGGCTATGAAAATTATAAATTTATAAATAGAACTGTTTGCGG
GACTCCAAATTATATAGCTCCTGAAGTTCTTAAAAATCAAGGTCATGATTACTTAGTTGA
TAACTGGGCCATTGGAGTGATAGTTTATACATTTTTAATCGGTAAGCCACCATTCGAAGA
AAAAGAAGTTGAAAATACTCTGAGAAACATCAAGGCCAACAGATATTCTTTCCCTGTATT
TTCATAAGCCTTTTATAAAAAAATAACATTTTAATAAAATTTTTTTGTTTTATAAATAAT
TGTATTAGGAAAATTGTACAATTTCAAAAGAAGCAAAAGATTTTATTTAAAAAATCTTGG
TTCCTAATCCAGACTAGAGATTAACTATGGATTAAATGCTTCAACATCCATTTATGAAAA
GTGAAGAGTATTATATTCCTAAAACATTCCCAATAAGCACCTTAGCACTTCCTCCTACTG
CTAACTATTTAAGAAAATTACGCAAAAGCGAGTCTGTTCTAGCTCCGAAATCTTAATTAT
AATTAGCAAATAATGGAGCTCAGCCTTATGATTATAATTGCCAGAATGAAAACTAAACAC
CTCATATATCAACAACCCAATCCACAAAGCATTTTTAGCGTAGTAATCACTTCTACTAAA
CCCAAAGCAGCAGTACTGCTAACTTTAAACCTACTTCACTATCTCAGCAGCATGCTACTA
CAAATTCTAATAACTTATAGGACACTAATTCTACTAATACAAACGAAAATAATACAATAA
GCAGTAACAACCCTAATAATAATGAGATAAACATAGCTAACTAAGAAAATGACAATTATC
AATTATTGCGCATGAGAAGCTAAGAAAATATTCAATTTTCTCGTTAATTCTAAAATTACT
TCTAAGGTAAAAAAGAAAACTCTCTCCAAAAGTACCCAAGCAGTTAATAATTTACTGGAA
ATCCAATCTCATCTAATTAAAATATACTTAATTAGCACTAAAGTCCTCCAAAAAATTTAA
ATACAGCTGCTGGATATTCCTCTGTAGAGAAGCCAAGTTACTCCCAAAGCTCTTAAACAA
AAGTCCCAACCCTTACTTCTTCTTAAAAATTCGATATCAAAAAATATAATACTATTCACA
TTTCTGACACAAATTAAAATTAAAATCATAACAAAGCCAATAATCCTTATTACAATCTTC
CTGCATAAAGTGGTTAGCAAAACTCAAATTAGTCACCTTTAGAGTAAATAAATCTTCTGA
CTCAAAAGTAAAATATTTATTTATTCGATTACATTGACTGCAGCAGCAAATTTGGTCTGG
CATACTACTTGAATAACGGAAACGTAGGTATCTTACTGAATGATGGAAATGTAACCTAAA
TCGTTGATGAGTAAATACTATCCTTTTTAAAATCTTTTTAAACCATTAAATATAAATTTA
ATATTGTAATAAAATAGAACGTTTGAGCACATCTAAAAAGTTTAAGACAACTATGTTATT
CAAAAGTATCCTATTAAATAGATACCTCCCTCATGCTAAAACTTGTTTAGACTGACCACA
AATATAAAAGAATACTTCCTCAACAAATACAAACTTATTTGTGTAAAATATATTTTATAT
TATACCAAACAAAAATGATAAAATTTATTTTTATTTAAATAAAGCCGAAAGTTGAATTGT
AAGAAGGAGATTTTGAAAAAGAAGTCTATCTGAAAAAGTTCATTTCAACTAAATAAGCTT
CCTTTTTTAGATTTAGTAACAAAGATCTTTAAGTTATTTTTATTGATAAGAGTGAAGTTG
TTATCACTTAGCAAAATAAAAATCTATACTTCAAAGATAAGAATGGAACTCAAAAAATTC
ACACATTAAACCATGAAGATAAGTCTTCGTTACCTCATAATATTAGAAAAAGAATATTGT
ATATTAAAGATGTTTTCCTAAGTGGTAATCACTCAAAGACACAATAAGCTAACAAGCTAC
AAGGAACTGATAACTAATAAAATAGTGGCTAAAACCCTACAAAATACTCTTCAACTACTC
CTAGCAGTAATAATTAAGTTTAACCTTCCTCTGTCCCTTGCTCTCCCCCAATCTCATCTT
TAACTCATTCATCAAGTTAAAACTAAAAATTAACGCAAGCTGCTAATAATATTGTTAACC
CTGCATAGCAAATGTCGGCATCATCCTTAACTTAGTATTAATCTGTACCACTTTAAAATG
GTTAAAATTAAGCATCTATGTTCAATTCTACTTACCAATAAGGTTTTAATTAAAATAATC
CTTAGTCATCTTCATTATCCCCTTTAAATTCTATCAATTAAAATATATCTCCAGTTTAGT
AAGACCCTAACAATAATATTAGCAACAATCTCCAAAACAATATATAATTCAGCTAAATAA
TGAAAACAAACAATAACACTACCTCTTCTACTAACAACTCTGTATCAACATCATAATAAA
CTCCATAATAATAAGTGCTTAACCAAATTAAATACAATAATAGTTAACAACTCTCTTAAA
CTGCAAAACTATCACTTTACTAGTCTTAAAAGTTAAGAGTTTCTGTTGAAAATTATCAAT
CTCCTGTCTCAAAGCCTGTTTAAAACGCTCCTTCAGTCTATCCTCTTAAAATGTATTAAT
GA


>TTHERM_00470890(protein)
MSTENQNQQQKPAQDPVSCYQAQPQRNLLHEKRKNQDGEWKVERSYEVLSKLGKGGFAKV
YLAKDISSNEQYAIKVVDKSSLEKDSFKEKLNQEIKIQKSLNHENVVKYYTSFEDSQNVY
IVLEYCSNQTFKELLDRRKRLTEIEVKSHLFQIIQSLKYIHSKGVIHRDLKIANIFLNDK
MVVKLADFGLSAMMKNAQKRKTVCGTPNYIAPEVLKNQGHDYLVDNWAIGVIVYTFLIGK
PPFEEKEVENTLRNIKANRYSFPENCTISKEAKDFIQKILVPNPDQRLTMDQMLQHPFMK
SEEYYIPKTFPISTLALPPTANYLRKLRKSESVLAPKSQLQLANNGAQPYDYNCQNENQT
PHISTTQSTKHFQRSNHFYQTQSSSTANFKPTSLSQQHATTNSNNLQDTNSTNTNENNTI
SSNNPNNNEINIANQENDNYQLLRMRSQENIQFSRQFQNYFQGKKENSLQKYPSSQQFTG
NPISSNQNILNQHQSPPKNLNTAAGYSSVEKPSYSQSSQTKVPTLTSSQKFDIKKYNTIH
ISDTNQNQNHNKANNPYYNLPAQSGQQNSNQSPLEQINLLTQKQNIYLFDYIDCSSKFGL
AYYLNNGNVGILLNDGNVTQIVDETFEHIQKVQDNYVIQKYPIKQIPPSCQNLFRLTTNI
KEYFLNKYKLICPKVELQEGDFEKEVYLKKFISTKQASFFRFSNKDLQVIFIDKSEVVIT
QQNKNLYFKDKNGTQKIHTLNHEDKSSLPHNIRKRILYIKDVFLSGNHSKTQQANKLQGT
DNQQNSGQNPTKYSSTTPSSNNQVQPSSVPCSPPISSLTHSSSQNQKLTQAANNIVNPAQ
QMSASSLTQYQSVPLQNGQNQASMFNSTYQQGFNQNNPQSSSLSPLNSINQNISPVQQDP
NNNISNNLQNNIQFSQIMKTNNNTTSSTNNSVSTSQQTPQQQVLNQIKYNNSQQLSQTAK
LSLYQSQKLRVSVENYQSPVSKPVQNAPSVYPLKMYQ