Identifiers and Description

Gene Model Identifier

TTHERM_00471040

Standard Name

CCF8 (C-terminal Crystallin Fold 8)

Aliases

PreTt22518 | 56.m00222 | 3686.m00065

Description

CCF8 Putative 8-oxo-dGTP diphosphatase; C-terminal crystallin fold protein; domain structure and protein isolation suggest localization in dense core granules; contains four copies of a 200-residue motif weakly conserved among CCF6- CCF7- CCF8- and IGR1

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11335.1 9.997093137033517e-262
Description: hypothetical protein (974 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00471040(coding)
ATGAGTAGGAGAGTCCAATAAATGCTATTAATTATAGCTCTTTTAGGTACTCTTTAGGTT
GTCACATCTTAAAAAATTATTGTATCAAGCTACATTCAAGCCAAAGCTTAAAATGTGATT
ACAGTACCTAAAGATTAACTATCATAAATTAAATCACTTTCGATTGAAGGTTGGGTTCGC
CCTTCTTAAACTATGGATTACCCATATCCCGCATCTGTTCCAAGAAAGAGTTATTCTTTA
ATTATGGGTTCTAGTACTTCTAGTTCTGGTTGGGGTGATAATGTTAAGGGAGTTGACTCA
TTTTTGAACTTATACACAAATAAGTGGACAGATCAATCCGGCTTTATTTTAGCCTATGAA
AATGGAAAGAACTTCGAATACATTTACAATAACTTAAGATATGCTGATTTCTTTGGTCGT
TGGTTTTTTGTCTACGGTGTCTATCTTAGTGATATATAAAAACATTATTTAGTAACTTAT
AGCGCTTATGACGAATCTTGGTAAGAGGCTATTTCATCTGTTGTAAAGAAAAATCCCATC
ATCGACTTTTATCAATTTAGTGTTAACTCTTAAGATGTTAAAAAGTCAGTTTAATTCAAT
GGATATATTGCTGATCCAAATTTGACATATTCAGCTTCTTCCTCTTACTATAGCTCTTTA
GATTAACTAAAGGCATACATTTCATAAAAATAATAAAAACCAAAATATATTGGAGTACTT
TAAAAAACAGTATTCACATACATTGGTCAAAGTGCTACCATACCAGATGGTGGTTTATAT
GAGTCTTTCGGTAATTACTAAGGAGCAGATGAATACTCAATTAATGGTTAAGCTCAATTT
ACTGGTGCTTTCGCATCTGTTGGTAATACTATCTTATTTAGACTTGGCACAAATAACCCA
GAAGTCTTCAAAAGTTTCTACGAAGAAGGAGATCTTGCTTTGTTAGCCTATGTTTAAAAT
GGTAAAAAAACTTGTATGCAAACTTATCGTATTAATCTGTCAGCAACTGATTTAACAAAC
GGTAAACAATGTTTTGATGTTGTTCCTAAGAAGGGAGAGTGGTTTTACTTCTATTAAGGT
TACAGCAGAAAACTTGGAAGAGTTTTTAACTATGTTAGAATTGGTGGTTAAAACTATTAT
GCTGCTACCACAGATGTTCTTCACGTTGATCCAAATGCTTTCTATTTATTCGTTGGTCAA
GATTCTGTTAGTATGAAATGGGCTGGTTCATTCTAAGGTTTTAACTTAGAATTTGGTCCT
GGTGCTTACAGAGAAACCCTAATCACTGAATTCCCTCCTGTTAAAGATAAATCAGTTAAA
GATAAAGTTGTCATTCCTAAGACATATGTTGATCCTTAAATCTTATAATCAAAGGCTTCC
TAAACTTTAGCTATTGATGCTAAAATTGTCAGCCAAAACTACATTAGTAGTGTAAAGGAA
TATGCTATTCATTTCTGGTTCAGAAGAGACTTAATTACTCCAGAATTAATTGACTTCTAA
GCAGCTAAATCATAATAATCTGTTGCAGGTGTTACAGAACGTGATGATTACACAAGTACT
GATGTTGCAGGAGATGCCGCTCTTTCAATTCAATATCTCGATCATTCTAAAGGTGATTCT
CCAGCTTTTGTTTTCACAACTTATAATGATGCAGGTTCAGACAAATTCAAATCAGCTACA
GTTAATTTTGATACTAAGTTCGATTAAGGTTAATGGATTTGGGTTTATTTTGCTTATAGC
TAACCTTTGCAATAAGCTAGTATTTATGTTGGATTACCTGATGGCTAAACAAAGATTGTT
AAACAGATTAACTAAGTAAGCCACTCATAAGCTCATAACTTAAAAGCTCTTATCGGAAGG
TCTGGTACAACAATGAACCCAGTAACAGGTCAATTTTACGATGCTTAATTCGTCTATTAT
GATGGATGTTATCAATCTTCCACTGCTACTATTGAAAACTATAAGGCTGCTAATGTCAAA
AATCCTCCTTCCACTCAACCAAAATAAGGTGTTTACAGTGCTTTTGATAGAAAATCATTT
AGCAAAAAAAATCCTCCTACATAAAACCCTAATTAATTCACCACTGAAGTTGCTGGTGCT
TTACAATATGGTTTAGCTGCTTGGGCTAGATGGAATAAGTCTTCCTTAAAGAATGCAGCT
GGTAATTTATTATTTACACTCTCGATTTACGATAAGACAACCATTGGAAAGACATATAAC
AAACTTGGTTCTCTTGTTCTCTAAGTTTATTACAAGAAAAAATACTTGTACTTTTCAACT
TACTAATACGTTCATGCTAAATTGAAAGATGTCAATCCTGCTGTTCAAAAATTCTTTGTT
CCAAAGAATGCTCGTACTTCTTGGTGTTATTACTACTTTGGATATTCTCACTTAGATCAA
TAAGCAGTTGGATCTGTCAAATGCTTATCAGGATTTTAACATGAAGTCAAATTTGATAAT
ACTAATCACATTATTCCATCAGCTTTTACCTTCCAAGTAGCCAAAGATGACATTTTAAAC
ATATGGAAAGGAGAAGTATATCAACCCTCTGTTATTATAGGATATCCTGTTGCTTTGAAC
TTTTAATATGATAACGCTTATTATCCTTAAGACCCTTCAAGCGGCTCTTTACCAGATGAT
GATGATTCTGGCAATAAGCAACCTGATGAAGGAGATGATGACGAACCAGAAGAAGAAGAT
GATCCAAAAGTCCCATCCAAGCCAGCAACTGACCCTTCCACTCCTGCTACCAACACAACC
ACTCCTGTAACTAATCCAGTTAATCCTGCAACTAACTCAACTACTCCTGTAACTAACACA
ACTACTCCTGAAACTAACCCAATTATTCCTGCAACTAACACAACCATTCCTGCAACTAAC
ACAACTACTCCTGCAACTAACACAACCACTCCTGATGTTACCCCAGTTATTCCTGCAACT
AACACAACCACTCCTGCTACTAACACAACCACTCCTGCTACTAACACAACTACTCCTACT
TAACCTTAATAGCCTAGTTGTGCAGTTATTTATTCAGAATGTGGTTACACTAATAAGATT
TAAGAAGTTTGTTAGAATATCCCTAGTTTAGAAATTAGAAATATTAGAAGTATTCAAGTA
CCTAATGGAACAACTCTTAAATTCTTCCAAAAAGAAAACTATAAAGGTGTTAATGTTAAA
TTTTTGTAAAGCGTAGAATGCATTGAATTAGGTTTGAAAGAAGACCCTAAAATTTAATGG
GATGATTTAGTAAAATTATTTAATGCTGGAAAAATCGGATTTATTGATTCAGAAGGTAAT
GATATTGGGCTTCACAAAGCTAAAAAAGTATTCTTTAAGACAAATCTAAGAATGTAACTT
AGAAAGAAACACTCAAGTGATTGA


>TTHERM_00471040(gene)
ATGAGTAGGAGAGTCCAATAAATGCTATTAATTATAGCTCTTTTAGGTACTCTTTAGGTT
GTCACATCTTAAAAAATTATTGTATCAAGCTACATTCAAGCCAAAGCTTAAAATGTGATT
ACAGTACCTAAAGATTAACTATCATAAATTAAATCACTTTCGATTGAAGGTTGGGTTCGC
CCTTCTTAAACTATGGATTACCCATATCCCGCATCTGTTCCAAGAAAGAGTTATTCTTTA
ATTATGGGTTCTAGTACTTCTAGTTCTGGTTGGGGTGATAATGTTAAGGGAGTTGACTCA
TTTTTGAACTTATACACAAATAAGTGGACAGATCAATCCGGCTTTATTTTAGCCTATGAA
AATGGAAAGAACTTCGAATACATTTACAATAACTTAAGATATGCTGATTTCTTTGGTCGT
TGGTTTTTTGTCTACGGTGTCTATCTTAGTGATATATAAAAACATTATTTAGTAACTTAT
AGCGCTTATGACGAATCTTGGTAAGAGGCTATTTCATCTGTTGTAAAGAAAAATCCCATC
ATCGACTTTTATCAATTTAGTGTTAACTCTTAAGATGTTAAAAAGTCAGTTTAATTCAAT
GGATATATTGCTGATCCAAATTTGACATATTCAGCTTCTTCCTCTTACTATAGCTCTTTA
GATTAACTAAAGGCATACATTTCATAAAAATAATAAAAACCAAAATATATTGGAGTACTT
TAAAAAACAGTATTCACATACATTGGTCAAAGTGCTACCATACCAGATGGTGGTTTATAT
GAGTCTTTCGGTAATTACTAAGGAGCAGATGAATACTCAATTAATGGTTAAGCTCAGTAA
TTAATTTTTATATCCTTTAAATAAAAAAATTATAAAAAAAATAAATTAATTTATCAAATA
AAAATATAAAATTAGATTTACTGGTGCTTTCGCATCTGTTGGTAATACTATCTTATTTAG
ACTTGGCACAAATAACCCAGAAGTCTTCAAAAGTTTCTACGAAGAAGGAGATCTGTAAGA
AATTAATTGTTATATATATTAACAAAATTTAAATTTATTTTTATAATTTTTTAGTGCTTT
GTTAGCCTATGTTTAAAATGGTAAAAAAACTTGTATGCAAACTTATCGTATTAATCTGTC
AGCAACTGATTTAACAAACGGTAAACAATGTTTTGATGTTGTTCCTAAGAAGGGAGAGTG
GTTTTACTTCTATTAAGGTTACAGCAGAAAACTTGGAAGAGTTTTTAACTATGTTAGAAT
TGGTGGTTAAAACTATTATGCTGCTACCACAGATGTTCTTCACGTTGATCCAAATGCTTT
CTATTTATTCGTTGGTCAAGATTCTGTTAGTATGAAATGGGCTGGTTCATTCTAAGGTTT
TAACTTAGAATTTGGTCCTGGTGCTTACAGAGAAACCCTAATCACTGAATTCCCTCCTGT
TAAAGATAAATCAGTTAAAGATAAAGGTAATCATATATTTTATTTAGACAAAACACTAAT
AAAGCAATTTAATTTTAATTATAGTTGTCATTCCTAAGACATATGTTGATCCTTAAATCT
TATAATCAAAGGCTTCCTAAACTTTAGCTATTGATGCTAAAATTGTCAGCCAAAACTACA
TTAGTAGTGTAAAGGAATATGCTATTCATTTCTGGTTCAGAAGAGACTTAATTACTCCAG
AATTAATTGACTTCTAAGCAGCTAAATCATAATAATCTGTTGCAGGTGTTACAGAACGTG
ATGATTACACAAGTACTGATGTTGCAGGAGATGCCGCTCTTTCAATTCAATATCTCGATC
ATTCTAAAGGTGATTCTCCAGCTTTTGTTTTCACAACTTATAATGATGCAGGTTCAGACA
AATTCAAATCAGCTACAGTTAATTTTGATACTAAGTTCGATTAAGGTTAATGGATTTGGG
TTTATTTTGCTTATAGCTAACCTTTGCAATAAGCTAGTATTTATGTTGGATTACCTGATG
GCTAAACAAAGATTGTTAAACAGATTAACTAAGTAAGCCACTCATAAGCTCATAACTTAA
AAGCTCTTATCGTAATTTAATAAAGCATTATTTTCAAGATTTAATTATTTTAACTAATCA
AATATAGGGAAGGTCTGGTACAACAATGAACCCAGTAACAGGTCAATTTTACGATGCTTA
ATTCGTCTATTATGATGGATGTTATCAATCTTCCACTGCTACTATTGAAAACTATAAGGC
TGCTAATGTCAAAAATCCTCCTTCCACTCAACCAAAATAAGGTGTTTACAGTGCTTTTGA
TAGAAAATCATTTAGCAAAAAAAATCCGTAAAATTTTTCAATATTTTTAATTGTGATAAC
TTATTAAATTTTTAATTTAATAGTCCTACATAAAACCCTAATTAATTCACCACTGAAGTT
GCTGGTGCTTTACAATATGGTTTAGCTGCTTGGGCTAGATGGAATAAGTCTTCCTTAAAG
AATGCAGCTGGTAATTTATTATTTACACTCTCGATTTACGATAAGACAACCATTGGAAAG
ACATATAACAAACTTGGTTCTCTTGTTCTCTAAGTTTATTACAAGAAAAAATACTTGTAC
TTTTCAACTTACTAATACGTTCATGCTAAATTGAAAGATGTCAATCCTGCTGTTCAAAAA
TTCGTAATTTATTGTTTATATATTTGTATTTTAAAATAAGTTTAATAAATTTTGTCAAAT
TAAATTAGTTTGTTCCAAAGAATGCTCGTACTTCTTGGTGTTATTACTACTTTGGATATT
CTCACTTAGATCAATAAGCAGTTGGATCTGTCAAATGCTTATCAGGATTTTAACATGAAG
TCAAATTTGATAATACTAATCACATTATTCCATCAGCTTTTACCTTCCAAGTAGCCAAAG
ATGACATTTTAAACATATGTAAAATTATAATAAAGTTTTTAATAGCTTAATAAATTTATT
ATTGTTTTGAATTTTAGGGAAAGGAGAAGTATATCAACCCTCTGTTATTATAGGATATCC
TGTTGCTTTGAACTTTTAATATGATAACGCTTATTATCCTTAAGACCCTTCAAGCGGCTC
TTTACCAGATGATGATGATTCTGGCAATAAGCAACCTGATGAAGGAGATGATGACGAACC
AGAAGAAGAAGATGATCCAAAAGTCCCATCCAAGCCAGCAACTGACCCTTCCACTCCTGC
TACCAACACAACCACTCCTGTAACTAATCCAGTTAATCCTGCAACTAACTCAACTACTCC
TGTAACTAACACAACTACTCCTGAAACTAACCCAATTATTCCTGCAACTAACACAACCAT
TCCTGCAACTAACACAACTACTCCTGCAACTAACACAACCACTCCTGATGTTACCCCAGT
TATTCCTGCAACTAACACAACCACTCCTGCTACTAACACAACCACTCCTGCTACTAACAC
AACTACTCCTACTTAACCTTAATAGCCTAGTTGTGCAGTTATTTATTCAGAATGTGGTTA
CACTAATAAGATTTAAGAAGTTTGTTAGAATATCCCTAGTTTAGAAATTAGAAATATTAG
AAGTATTCAAGTACCTAATGGAACAACTCTTAAATTCTTCCAAAAAGAAAACTATAAAGG
TGTTAATGTTAAATTTTTGTAAAGCGTAGAATGCATTGAATTAGGTTTGAAAGAAGACCC
TAAAATTTAATGGGATGATTTAGTAAAATTATTTAATGCTGGAAAAATCGGATTTATTGA
TTCAGAAGGTAATGATATTGGGCTTCACAAAGCTAAAAAAGTATTCTTTAAGACAAATCT
AAGAATGTAACTTAGAAAGAAACACTCAAGTGATTGA


>TTHERM_00471040(protein)
MSRRVQQMLLIIALLGTLQVVTSQKIIVSSYIQAKAQNVITVPKDQLSQIKSLSIEGWVR
PSQTMDYPYPASVPRKSYSLIMGSSTSSSGWGDNVKGVDSFLNLYTNKWTDQSGFILAYE
NGKNFEYIYNNLRYADFFGRWFFVYGVYLSDIQKHYLVTYSAYDESWQEAISSVVKKNPI
IDFYQFSVNSQDVKKSVQFNGYIADPNLTYSASSSYYSSLDQLKAYISQKQQKPKYIGVL
QKTVFTYIGQSATIPDGGLYESFGNYQGADEYSINGQAQFTGAFASVGNTILFRLGTNNP
EVFKSFYEEGDLALLAYVQNGKKTCMQTYRINLSATDLTNGKQCFDVVPKKGEWFYFYQG
YSRKLGRVFNYVRIGGQNYYAATTDVLHVDPNAFYLFVGQDSVSMKWAGSFQGFNLEFGP
GAYRETLITEFPPVKDKSVKDKVVIPKTYVDPQILQSKASQTLAIDAKIVSQNYISSVKE
YAIHFWFRRDLITPELIDFQAAKSQQSVAGVTERDDYTSTDVAGDAALSIQYLDHSKGDS
PAFVFTTYNDAGSDKFKSATVNFDTKFDQGQWIWVYFAYSQPLQQASIYVGLPDGQTKIV
KQINQVSHSQAHNLKALIGRSGTTMNPVTGQFYDAQFVYYDGCYQSSTATIENYKAANVK
NPPSTQPKQGVYSAFDRKSFSKKNPPTQNPNQFTTEVAGALQYGLAAWARWNKSSLKNAA
GNLLFTLSIYDKTTIGKTYNKLGSLVLQVYYKKKYLYFSTYQYVHAKLKDVNPAVQKFFV
PKNARTSWCYYYFGYSHLDQQAVGSVKCLSGFQHEVKFDNTNHIIPSAFTFQVAKDDILN
IWKGEVYQPSVIIGYPVALNFQYDNAYYPQDPSSGSLPDDDDSGNKQPDEGDDDEPEEED
DPKVPSKPATDPSTPATNTTTPVTNPVNPATNSTTPVTNTTTPETNPIIPATNTTIPATN
TTTPATNTTTPDVTPVIPATNTTTPATNTTTPATNTTTPTQPQQPSCAVIYSECGYTNKI
QEVCQNIPSLEIRNIRSIQVPNGTTLKFFQKENYKGVNVKFLQSVECIELGLKEDPKIQW
DDLVKLFNAGKIGFIDSEGNDIGLHKAKKVFFKTNLRMQLRKKHSSD