Identifiers and Description

Gene Model Identifier

TTHERM_00471730

Standard Name

NCB2 (nuclear cap-binding protein subunit 2)

Aliases

PreTt22581 | 56.m00285 | 3686.m00128

Description

NCB2 nuclear cap-binding protein subunit 2; nuclear cap binding protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11273.1 3.999369102302453e-125
Description: nuclear cap binding protein (234 aa)
DictyBase DDB_G0287197 3.00039543526891e-44
Description: ncbp2 on chromosome: 4 position 5395993 to 5396806
Oxytricha Contig9742.0.g62 2.0005131442217614e-40
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)
WormBase WBGene00009141 1.9998323414791308e-36
Description: locus:ncbp-2 Nuclear cap-binding protein subunit 2 status:Confirmed UniProt:Q93594 protein_id:CCD31067.1
SGD YPL178W 1.000137892321693e-31
Description: CBC2 Small subunit of the heterodimeric cap binding complex that also contains Sto1p, component of the spliceosomal commitment complex; interacts with Npl3p, possibly to package mRNA for export from the nucleus; contains an RNA-binding motif
Stentor Coeruleus SteCoe_18840 0.000000000000012664165549094176
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00471730(coding)
ATGGCATCCTTTTTGTATGATAGTCTTTAACCTTAGAGTTTGTATTATGATAAAAAATCA
GAACTTAGCGAATAGGATTATAAAAAAAGACTTGAAACTACTACAACTGTATATGTAGGA
AATTTACATTTCCAAACAAGAGAGAGCGCACTTTATGAATTATTCTCTCGTGCAGGATAA
ATTAAAGATCTTATAATGGGTATTAATAAAGAAGGTTAATCAGCAGGATTCTGTTTTGTT
GTTTACCACACTCACGAAGAAGCTAGAATAGCAGTTGAATATATTTCATAGACAAAACTA
AATGATAGAGTGATTAGAGTAGATTGGGATTATGGTTTTAAAGAAGGAAGATAGTTTGGA
AGAGGTATGGATGGATATCAAAAAAGAGATTAATACAGATAATAAAATGACTCTGGACGT
CATAATATTCATTAGTAATGGAAGGAGCGTTAACAATAGCAATTTTAAGAAAGGTCTAAT
AGTAGAGGTGGCTTTAGAGGGGGCAACAACTATAATTAAGGATAAAGAGAAGGTTATAAG
GGAAGGTTTAATAATAATTAGGGCAATCATAACTTTGATGAAAATAGTTAAAATAGATAT
AAAAAGAGCTACAACTAATTTAGAAATGAACAAAAAGAAAGAAGTAATTCAAGTTCTCCA
GAATATCCTAAGAAAAAGAGATAATAGTAAGATGATGAAAATGATGATTGA


>TTHERM_00471730(gene)
ATGGCATCCTTTTTGTATGATAGTCTTTAACCTTAGAGTTTGTATTATGATAAAAAATCA
GAACTTAGCGAATAGGATTATAAAAAAAGACTTGAAACTACTACAACTGTATATGTAGGA
AATTTACATTTCCAAACAAGAGAGAGCGCACTTTATGAATTATTCTCTCGTGCAGGATAA
ATTAAAGATCTTATAATGGGTATTAATAAAGAAGGTTAATCAGCAGGATTCTGTTTTGTT
GTGTAATTTAAGTTATTTTTTGAAAAATTTATAATTTTGTTTAAATAAATGTGTAAAAAT
ATATAATAGCTATAAATATATAAATTTCGTTATTTAAAAAAAGTTACCACACTCACGAAG
AAGCTAGAATAGCAGTTGAATATATTTCATAGACAAAGTTGGTTATTAAATTTTATCATT
TAAAAAAATCTAACTAGTTACTAAGAAAAATTTTAATTTATTAAAACTTAGACTAAATGA
TAGAGTGATTAGAGTAGATTGGGATTATGGTTTTAAAGAAGGAAGATAGTTTGGAAGAGG
TATGGATGGATATCAAAAAAGAGATTAATACAGATAATAAAATGACTCTGGACGTCATAA
TATTCATTAGTAATGGAAGGAGCGTTAACAATAGCAATTTTAAGAAAGGTCTAATAGTAG
AGGTGGCTTTAGAGGGGGCAACAACTATAATTAAGGATAAAGAGAAGGTTATAAGGGAAG
GTTTAATAATAATTAGGGCAATCATAACTTTGATGAAAATAGTTAAAATAGATATAAAAA
GAGCTACAACTAATTTAGAAATGAACAAGTATATTTATAAATATTTTAATTGTAAATTAA
TTAATATCATTTTATCATAATACAATAGAAAGAAAGAAGTAATTCAAGTTCTCCAGAATA
TCCTAAGAAAAAGAGATAATAGTAAGATGATGAAAATGATGATTGA


>TTHERM_00471730(protein)
MASFLYDSLQPQSLYYDKKSELSEQDYKKRLETTTTVYVGNLHFQTRESALYELFSRAGQ
IKDLIMGINKEGQSAGFCFVVYHTHEEARIAVEYISQTKLNDRVIRVDWDYGFKEGRQFG
RGMDGYQKRDQYRQQNDSGRHNIHQQWKERQQQQFQERSNSRGGFRGGNNYNQGQREGYK
GRFNNNQGNHNFDENSQNRYKKSYNQFRNEQKERSNSSSPEYPKKKRQQQDDENDD