Identifiers and Description

Gene Model Identifier

TTHERM_00471830

Standard Name

RPN10 (26S Proteasome Regulatory subunit N10)

Aliases

PreTt22591 | 56.m00295 | 3686.m00138

Description

RPN10 ubiquitin interaction motif protein; Ubiquitin interaction motif family protein; assists in protein degradation

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF02809 ) Ubiquitin interaction motif

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11262.1 9.997093137033517e-262
Description: ubiquitin interaction domain-containing protein family protein (390 aa)
Oxytricha Contig18962.0.g37 1.9992362000979228e-56
Description: von Willebrand factor type A domain
SGD YHR200W 1.9998745702418095e-48
Description: RPN10 Non-ATPase base subunit of the 19S regulatory particle (RP) of the 26S proteasome; N-terminus plays a role in maintaining the structural integrity of the RP; binds selectively to polyubiquitin chains; homolog of the mammalian S5a protein
DictyBase DDB_G0275775 2.99915080840225e-45
Description: psmD4 on chromosome: 2 position 5689186 to 5690969
Stentor Coeruleus SteCoe_18678 1.603810890548638e-28
Description: None
WormBase WBGene00004466 9.997975313387782e-28
Description: locus:rpn-10 status:Confirmed UniProt:O61742 protein_id:CCD61298.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00471830(coding)
ATGACTCTAGAAGCTTCAATTGTTATTTTAGATAATACCGAATATGCAAGAAATGGGGAC
CATTTGCCTTCCAGATATGAAGCATAAGCAGAAACAATCCAGGCTATAATAAATGCAAAA
TAATAAATGAATATGGAAAATGCAGTTGGTATATTAACTATGGGAGGCCCATAAGTTGAA
GTATTAATCACACCTAGCGCAGATCCTGATGCTATTTTAGGCTGCTTATTTGGCGTAAAG
CTTAGAGGTGAAAAAGCTCACTTTTTAAATGCTCTTTAAATTGCTTAGCTTGGATTAAAA
CACAGAAAAAATAAAAATATGAGATAAAGGATAATCGTTTTTGTTGCATCACCAATTGTT
GAAGATGAAAAAACTTTGGAAAGAGTTGCAAAGTAATTAAAAAAGAATAATGTTAGTGTT
GATATTGTTAATCTATGTTAAAGTGGAGTTAATTAAATTGAAAAACTAGACAAATTCATT
CAAACTGTTAATTCAGGTGATTCTTCATACTTTTTAAATGTTTAAAGCGGCATTACTAGT
TTAACAGAAACCCTCTTTAACTCTCCTATATTAAACCGTTTCCTTAGTGGTTCTAACGCT
AACTAAGCCTCGAGTGTAGGTAATGTACCAATCAATCCAACCTAAGCTGGTGGAGCTAAT
CCATTTGCTGAATATGGTGGAATTGATCCCTCTGAAGACCCCGAATTAGCTTAAGCTATG
AAGCTTTCTCTAGAAGAAGAAAAGAGAATTTAAGAATAATTAGAGAGAGAAAAGAATTAA
TAATAATAATAATAGCAAGCACCTAGTTAACCAGCATAAGAAAATGCAACTAGCTTGGCT
TAATAGAATTTAAATACTTCTGCAAATAATCCATCATTTGTAAATGAAACAATGTAAGAT
GAAAATTAGGGCCTTTTAGCAAACAAAGATGATTTTGATGAATTGACAGAAGAAGAGTTG
ATGAATCAAGCTATATTAGCTTCATAATAAGAAAACCCATTTGAAGCATAGCAAGGAGCA
GAAAACAAAGAACCTAGAAAAGAATAAACCAAAAAAGAAGATGATGAATCTGTATAAGCT
AATTTAATGTAGGATGAAAAGTTTGTTGAAGATTTGTTAAATTTAGTTGGTAAAGGAGAT
GAGAAAAAAGATGATAAAAAAGAAAATGAAAAGAAGTGA


>TTHERM_00471830(gene)
ATGACTCTAGAAGCTTCAATTGTTATTTTAGATAATACCGAATATGCAAGAAATGGGGAC
CATTTGCCTTCCAGATATGAAGCATAAGCAGAAACAATCCAGGCTATAATAAATGCAAAA
TAATAAATGAATATGGAAAATGCAGTTGGTATATTAACTATGGGAGGCCCATAAGTTGAA
GTATTAATCACACCTAGCGCAGATCCTGATGCTATTTTAGGCTGCTTATTTGGCGTAAAG
CTTAGAGGTGAAAAAGCTCACTTTTTAAATGCTCTTTAAATTGCTTAGCTTGGATTAAAA
CACAGAAAAAATAAAAATATGAGATAAAGGATAATCGTTTTTGTTGCATCACCAGTAATT
AATTTATTATTTAAACTAATTTTTCAAACTTATAAAAGCATTAAAACTTTAAATTAAATA
TGAAAACTACATAAAATATTTTAGTAGGAATTTTATTTTTGTTGAAAGAAAGAAAGATTT
GAATTTTTAATTTTTAATAAATTTTATAATTTTTGTTAAATAAATGATTATTTATAAATA
TAAAATTAGATTGTTGAAGATGAAAAAACTTTGGAAAGAGTTGCAAAGTAATTAAAAAAG
AATAATGTTAGTGTTGATATTGTTAATCTATGTTAAAGTGGAGTTAATTAAATTGAAAAA
CTAGACAAATTCATTCAAACTGTTAATTCAGGTGATTCTTCATACTTTTTAAATGTTTAA
AGCGGCATTACTAGTTTAACAGAAACCCTCTTTAACTCTCCTATATTAAACCGTTTCCTT
AGTGGTTCTAACGCTAACTAAGCCTCGAGTGTAGGTAATGTACCAATCAATCCAACCTAA
GCTGGTGGAGCTAATCCATTTGCTGAATATGGTGGAATTGATCCCTCTGAAGACCCCGAA
TTAGCTTAAGCTATGAAGCTTTCTCTAGAAGAAGAAAAGAGAATTTAAGAATAATTAGAG
AGAGAAAAGAATTAATAATAATAATAATAGCAAGCACCTAGTTAACCAGCATAAGAAAAT
GCAACTAGCTTGGCTTAATAGAATTTAAATACTTCTGCAAATAATCCATCATTTGTAAAT
GAAACAATGTAAGATGAAAATTAGGGCCTTTTAGCAAACAAAGATGATTTTGATGAATTG
ACAGAAGAAGAGTTGATGAATCAAGCTATATTAGCTTCATAATAAGAAAACCCATTTGAA
GCATAGCAAGGAGCAGAAAACAAAGAACCTAGAAAAGAATAAACCAAAAAAGAAGATGAT
GAATCTGTATAAGCTAATTTAATGTAGGATGAAAAGTTTGTTGAAGATTTGTTAAATTTA
GTTGGTAAAGGAGATGAGAAAAAAGATGATAAAAAAGAAAATGAAAAGAAGTGA


>TTHERM_00471830(protein)
MTLEASIVILDNTEYARNGDHLPSRYEAQAETIQAIINAKQQMNMENAVGILTMGGPQVE
VLITPSADPDAILGCLFGVKLRGEKAHFLNALQIAQLGLKHRKNKNMRQRIIVFVASPIV
EDEKTLERVAKQLKKNNVSVDIVNLCQSGVNQIEKLDKFIQTVNSGDSSYFLNVQSGITS
LTETLFNSPILNRFLSGSNANQASSVGNVPINPTQAGGANPFAEYGGIDPSEDPELAQAM
KLSLEEEKRIQEQLEREKNQQQQQQQAPSQPAQENATSLAQQNLNTSANNPSFVNETMQD
ENQGLLANKDDFDELTEEELMNQAILASQQENPFEAQQGAENKEPRKEQTKKEDDESVQA
NLMQDEKFVEDLLNLVGKGDEKKDDKKENEKK