Identifiers and Description

Gene Model Identifier

TTHERM_00474670

Standard Name

MCF7 (Mitochondrial Carrier Family 7)

Aliases

PreTt02267 | 57.m00206 | 3709.m00066

Description

MCF7 graves disease carrier protein; Mitochondrial carrier protein; facilitates transport across mitochondrial membranes

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13143.1 1.999489510516749e-128
Description: mitochondrial carrier protein (337 aa)
Oxytricha Contig20765.0.g62 1.9997255150861791e-53
Description: Mitochondrial carrier protein
DictyBase DDB_G0292034 8.998739065740874e-48
Description: mcfP on chromosome: 6 position 1058459 to 1059755
SGD YPR011C 8.003782782428492e-46
Description: YPR011C Putative transporter, member of the mitochondrial carrier family; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies
WormBase WBGene00008147 9.99723014177113e-33
Description: status:Confirmed UniProt:Q18683 protein_id:CAA93110.1
Stentor Coeruleus SteCoe_32382 4.780892883885469e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00474670(coding)
ATGAAAAAAATTTTATTAATGCCACCTTTTTAACTTTTTTTTAAATTAAAAATGCTCAAT
AAAATTTATTATTTTGCTAATATTTTTAGAGTAGTTCAAATAATAAATATTTGCGCGAAA
TATTCATATGATATTTTATAAATATTAGATTGTTGGTTGCTAGAAATTACTTTAAATAGA
AGTAAAAAATATTAATTAATTTTAAAAAAAAACTTTGATTTATTATTTATCTAATCAATG
AACGATCTTTACAACTTTTTAGCTGGAGGTATCTCAGGAGTAGCTTCAAGAACAGCTGTA
GCTCCTATTGAAAGAGTGATCATCCTTAAGCAAACTTCTATTGAGTAGTATTAAGGAAGT
AATACAATTTAAGCTATTCTAAAAATGTATAAAATTGAAGGTGTAAGATCTCTCTTCAAA
GGCAATTATGTCAATTGTTTAAGAATATTCCCTTTTTAAGCTATTGAATTCTTCATGTTT
GATAAATACAAAAAATCATACAATCAATATATGTCAAGCTATATACAGCTAAACAGAGTA
GCTCTTGATCTAATAGCTGGAGCATTAGCTGGAGTTACAGCTTCTGCCTGCATTTATCCT
TTAGACTTAGCTAAGACTCATCTAGCTGTTAACATCTCAAAAACACCAAACGCATCTAAC
CCAGGATGTATATAAATTTGGAAAGAAATTATTCTTCATGAAGGTTTCAGAGGACTTTTT
AAAGGACTCTCTGCTACAATGATTGGCATGGCTCCTTATGCTAGCTTAAAGCTAACTTTC
TTCAATAACTTATAGTATTACGCAAGTAAATAGTTAAATAAAGATTAAAAATAAATGCCC
CTTTATTGGAACCTTGCTATTGGCGGTCTTTCAGGATGTCTAGCTGTTACTATAACCTAT
CCCACTGACCTGATTCGTAGAAATTTGCAAATAGCAAAAATGAATTCTAATACTAAACCA
ACTTATCTTAGTATAATAAAAAAAATTTACAACAAAAGTGGTTTAATTGGCCTATACAGA
GGGTTACCTGCAACTTACTGCAAAATTTTACCTTCTACAGCTATAGTTTTTGCAATCAAT
GACTGTTTGAAATAAATTAGAACAAAATTCCAAACAGGTAAACTCTTACAATATTGA


>TTHERM_00474670(gene)
ATGAAAAAAATTTTATTAATGCCACCTTTTTAACTTTTTTTTAAATTAAAAATGCTCAAT
AAAATTTATTATTTTGCTAATATTTTTAGAGTAGTTCAAATAATAAATATTTGCGCGAAA
TATTCATATGATATTTTATAAATATTAGATTGTTGGTTGCTAGAAATTACTTTAAATAGA
AGTAAAAAATATTAATTAATTTTAAAAAAAAACTTTGATTTATTATTTATCTAATCAATG
AACGATCTTTACAACTTTTTAGCTGGAGGTATCTCAGGAGTAGCTTCAAGAACAGCTGTA
GCTCCTATTGAAAGAGTGATCATCCTTAAGCAAACTTCTATTGAGTAGTATTAAGGAAGT
AATACAATTTAAGCTATTCTAAAAATGTATAAAATTGAAGGTGTAAGATCTCTCTTCAAA
GGCAATTATGTCAATTGTTTAAGAATATTCCCTTTTTAAGCTATTGAATTCTTCATGTTT
GATAAATACAAAAAATCATACAATCAATATATGTCAAGCTATATACAGCTAAACAGAGTA
GCTCTTGATCTAATAGCTGGAGCATTAGCTGGAGTTACAGCTTCTGCCTGCATTTATCCT
TTAGACTTAGCTAAGACTCATCTAGCTGTTAACATCTCAAAAACACCAAACGCATCTAAC
CCAGGATGTATATAAATTTGGAAAGAAATTATTCTTCATGAAGGTTTCAGAGGACTTTTT
AAAGGACTCTCTGCTACAATGATTGGCATGGCTCCTTATGCTAGCTTAAAGCTAACTTTC
TTCAATAACTTATAGTATTACGCAAGTAAATAGTTAAATAAAGATTAAAAATAAATGCCC
CTTTATTGGAACCTTGCTATTGGCGGTCTTTCAGGATGTCTAGCTGTTACTATAACCTAT
CCCACTGACCTGATTCGTAGAAATTTGCAAATAGCAAAAATGAATTCTAATACTAAACCA
ACTTATCTTAGTATAATAAAAAAAATTTACAACAAAAGTGGTTTAATTGGCCTATACAGA
GGGTTACCTGCAACTTACTGCAAAATTTTACCTTCTACAGCTATAGTTTTTGCAATCAAT
GACTGTTTGAAATAAATTAGAACAAAATTCCAAACAGGTAAACTCTTACAATATTGA


>TTHERM_00474670(protein)
MKKILLMPPFQLFFKLKMLNKIYYFANIFRVVQIINICAKYSYDILQILDCWLLEITLNR
SKKYQLILKKNFDLLFIQSMNDLYNFLAGGISGVASRTAVAPIERVIILKQTSIEQYQGS
NTIQAILKMYKIEGVRSLFKGNYVNCLRIFPFQAIEFFMFDKYKKSYNQYMSSYIQLNRV
ALDLIAGALAGVTASACIYPLDLAKTHLAVNISKTPNASNPGCIQIWKEIILHEGFRGLF
KGLSATMIGMAPYASLKLTFFNNLQYYASKQLNKDQKQMPLYWNLAIGGLSGCLAVTITY
PTDLIRRNLQIAKMNSNTKPTYLSIIKKIYNKSGLIGLYRGLPATYCKILPSTAIVFAIN
DCLKQIRTKFQTGKLLQY