Identifiers and Description

Gene Model Identifier

TTHERM_00475140

Standard Name

PDI1 (Protein Disulfide-Isomerase)

Aliases

PreTt02313 | 57.m00252 | 3709.m00112

Description

PDI1 protein disulfide-isomerase; protein disulfide-isomerase domain containing protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13191.1 9.997093137033517e-262
Description: protein disulfide-isomerase domain-containing protein (485 aa)
Oxytricha Contig9681.0.g59 5.997731685152085e-122
Description: Thioredoxin
WormBase WBGene00003963 1.0000198575659891e-106
Description: locus:pdi-2 Protein disulfide-isomerase 2 status:Confirmed UniProt:Q17770 protein_id:CCD63277.1
DictyBase DDB_G0291434 7.000472351131044e-82
Description: pdi2 on chromosome: 6 position 299936 to 301894
SGD YCL043C 9.997863464222902e-69
Description: PDI1 Protein disulfide isomerase; multifunctional protein resident in the endoplasmic reticulum lumen, essential for the formation of disulfide bonds in secretory and cell-surface proteins, unscrambles non-native disulfide bonds; forms a complex with Mnl1p that has exomannosidase activity, processing unfolded protein-bound Man8GlcNAc2 oligosaccharides to Man7GlcNAc2 which promotes degradation in the unfolded protein response
Stentor Coeruleus SteCoe_35059 7.667648073722e-53
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00475140(coding)
ATGAACAAGACTTTGCTTTTGTTAACTATTTTGGCTGTCGGTGCTTTGGCTTCCACTGCC
CCTGCTGTCGAAGAAGGTGTCTATGTCTTAACTGACTCCAACTTCAACGAATTCATTGCC
TCCAAGCCTTTTGTTTTGGTTGAATTCTACGCCCCTTGGTGTGGTCACTGCAAGAAGCTC
GCCCCCGAATATGCTAAGGCTGCTTAAGCTTTAGCCAGTGAAAACTCCTAAGCTGTTCTC
GCTAAGGTTGATGCCACTGAATAAAAGGACCTCGGTACTAGATTCTCCATCCAAGGTTTC
CCTACCTTGAAGTTCTTCATCAACGGTTCCACTGAAAACCCTGTTGACTTCAATGGTGGT
AGAACTGAAAAGGACATCCTTAACTGGATCAAGAAGAGAACCGGTTCCGTTTCTGAAGCT
CTTAACACTGCTGAAGAATTAACCGCCTTCACTCAAAAGAACCAAGTCGCCATCGTTTAT
TTCGGTGAAAGTGAAAAGGATGCCAACTACGAAGCCTTCAAGTCTTTGGCTATGTCTTAT
GATGACCTCGCCTTCGCTCACGTTTTCAACGCTGACTTGAGAACTGCTTAAAACGCTGCT
GCTCACAACCTCGTCCTCTACAAGCACTTCGATGAAAAGAGAAACGACTTCACTGGTACC
TTCAACGTTGCTAACTTAAAGACTTTCGTTGACACCAACTCTTTCCCCATCGTTATGCCC
TTCAACGACAGAGCCATCCAAAAGGTCTTCTAACAAGGTAACCCCACTTTGTTCCTTTTC
TCCAACAGCAACGAAGCTTCCCTTGCTGCTGAAAAGGCTTTCGCTGCTTCTGCTGAAGAA
AACAGAGGTAAGATCGTCTTCTCTATCTCCAAGCCTGATGACACCTTCGGTCACTACTAA
AAACTCGCTGACTACATCGGTGTTAACACTGCTTAAGTCCCCGCTTTAATGCTCGTTCAC
TCCAGCCACGAAGTTCTTAAGTACAAGTTCACTGCTTCTGAAATCACCCATGCCACCATT
AACTAATTCGTTAGTGACTACCTTGCTGGTAAGCTCTCAACTTACTTGAAGTCTGAAGAT
ATCCCTGCCACCAACGACGAACCCGTCAAGGTCCTCGTCGGCAAGAGTTTCGATGACCTC
GTCATTAACAGCAACAAGGATGTCTTAGTTGAATTCTACGCTCCCTGGTGCGGTCACTGC
AAGCAACTTGCTCCCATCTATGATGCCGTTGCCAAGAAGCTCTCCCACAACCACAACATC
GTCATCGCTAAGATCGATTCCACCGCTAACGAAGTTCCCGGAGTCAATATTAGAGGTTTC
CCCACCATTAAGTTCTATCAAAACGGTAAGAAATCTACTCCTCTTGATTTCGAAGGTGAC
AGAACTGAAGAAGGTATCCTCAAGTACCTCAAGGAAAAGACCACCTTCCCTTGGGTTGAA
AAGAACGAAGATCTCTGA


>TTHERM_00475140(gene)
ATGAACAAGACTTTGCTTTTGTTAACTATTTTGGCTGTCGGTGCTTTGGCTTCCACTGCC
CCTGCTGTCGAAGAAGGTGTCTATGTCTTAACTGACTCCAACTTCAACGAATTCATTGCC
TCCAAGCCTTTTGTTTTGGTTGAATTCTACGCCCCTTGGTGTGGTCACTGCAAGAAGCTC
GCCCCCGAATATGCTAAGGCTGCTTAAGCTTTAGCCAGTGAAAACTCCTAAGCTGTTCTC
GCTAAGGTTGATGCCACTGAATAAAAGGACCTCGGTACTAGATTCTCCATCCAAGGTTTC
CCTACCTTGAAGTTCTTCATCAACGGTTCCACTGAAAACCCTGTTGACTTCAATGGTGGT
AGAACTGAAAAGGACATCCTTAACTGGATCAAGAAGAGAACCGGTTCCGTTTCTGAAGCT
CTTAACACTGCTGAAGAATTAACCGCCTTCACTCAAAAGAACCAAGTCGCCATCGTTTAT
TTCGGTAAGCATATTTTATTTTTATCGTTTAGATGCAAACAATAAAGAGTATTTATAAAC
AAACGAATGGCTATCATATCAAATTTTTGTCTAATGGAAATCAGCATTCCATTAAGATAA
GTTAACTAACTCCCAAGAAAATTAATACATTAAATAGACTGCAAATAATTTTAATGTAGT
AACAAACTTTAAAGGATTATGAAAGCCATATAGGATAGCAGAGAAGTTACATGAAAGAAT
ATCATGAATGGAAGCCTTACAAATAATATAAAAGTTAGCTCCATAAAATTCCTATTCTGT
TATTTAAGAAAAAAAAAATAATTAGATGCAAAGCACTAACAAACAAATGAAATTATATAC
AGATTAAATACAATCAAGAGCAACTCATATAAAAATAAGCCTTTTTTAAGATGTTTCATC
AAAGCTTTTAAAGTTCTTGTTGACGTCAAAAAAAAAAAATTAAATTTTAAAAAATTTAAA
AAATATATTTTTCAAATAAAAAATACTAACACTAGCTAAATTGATAGTCATTCATTCATT
TATTCATTCATTATTAATAGAACATACTTCCACATAAATAACCAATAAGCCATCAAAAAA
TTTTATAATACTTAACCTAGAAAGAATGATAAGCCATTAATATTCAGTCATTAATTAATT
TGTTTTTAATCATTAGGTGAAAGTGAAAAGGATGCCAACTACGAAGCCTTCAAGTCTTTG
GCTATGTCTTATGATGACCTCGCCTTCGCTCACGTTTTCAACGCTGACTTGAGAACTGCT
TAAAACGCTGCTGCTCACAACCTCGTCCTCTACAAGCACTTCGATGAAAAGAGAAACGAC
TTCACTGGTACCTTCAACGTTGCTAACTTAAAGACTTTCGTTGACACCAACTCTTTCCCC
ATCGTTATGCCCTTCAACGACAGAGCCATCCAAAAGGTCTTCTAACAAGGTAACCCCACT
TTGTTCCTTTTCTCCAACAGCAACGAAGCTTCCCTTGCTGCTGAAAAGGCTTTCGCTGCT
TCTGCTGAAGAAAACAGAGGTAAGATCGTCTTCTCTATCTCCAAGCCTGATGACACCTTC
GGTCACTACTAAAAACTCGCTGACTACATCGGTGTTAACACTGCTTAAGTCCCCGCTTTA
ATGCTCGTTCACTCCAGCCACGAAGTTCTTAAGTACAAGTTCACTGCTTCTGAAATCACC
CATGCCACCATTAACTAATTCGTTAGTGACTACCTTGCTGGTAAGCTCTCAACTTACTTG
AAGTCTGAAGATATCCCTGCCACCAACGACGAACCCGTCAAGGTCCTCGTCGGCAAGAGT
TTCGATGACCTCGTCATTAACAGCAACAAGGATGTCTTAGTTGAATTCTACGCTCCCTGG
TGCGGTCACTGCAAGCAACTTGCTCCCATCTATGATGCCGTTGCCAAGAAGCTCTCCCAC
AACCACAACATCGTCATCGCTAAGATCGATTCCACCGCTAACGAAGTTCCCGGAGTCAAT
ATTAGAGGTTTCCCCACCATTAAGTTCTATCAAAACGGTAAGAAATCTACTCCTCTTGAT
TTCGAAGGTGACAGAACTGAAGAAGGTATCCTCAAGTACCTCAAGGAAAAGACCACGTAA
ATAACATTTTATACAAAATTTTATTCAAAAGTTATTGATTGTAAAGAAATCATATCTAAA
TATATTTTTTTTTAATTTATAGCTTCCCTTGGGTTGAAAAGAACGAAGATCTCTGA


>TTHERM_00475140(protein)
MNKTLLLLTILAVGALASTAPAVEEGVYVLTDSNFNEFIASKPFVLVEFYAPWCGHCKKL
APEYAKAAQALASENSQAVLAKVDATEQKDLGTRFSIQGFPTLKFFINGSTENPVDFNGG
RTEKDILNWIKKRTGSVSEALNTAEELTAFTQKNQVAIVYFGESEKDANYEAFKSLAMSY
DDLAFAHVFNADLRTAQNAAAHNLVLYKHFDEKRNDFTGTFNVANLKTFVDTNSFPIVMP
FNDRAIQKVFQQGNPTLFLFSNSNEASLAAEKAFAASAEENRGKIVFSISKPDDTFGHYQ
KLADYIGVNTAQVPALMLVHSSHEVLKYKFTASEITHATINQFVSDYLAGKLSTYLKSED
IPATNDEPVKVLVGKSFDDLVINSNKDVLVEFYAPWCGHCKQLAPIYDAVAKKLSHNHNI
VIAKIDSTANEVPGVNIRGFPTIKFYQNGKKSTPLDFEGDRTEEGILKYLKEKTTFPWVE
KNEDL