Identifiers and Description

Gene Model Identifier

TTHERM_00475220

Standard Name

RPB82 (RNA polymerases I, II,and III RNA common subunit RPB8B)

Aliases

PreTt02321 | 57.m00260 | 3709.m00120 | RPB8B

Description

RPB82 RNA polymerase rpb8; RNA polymerase subunit ABC14.5- common to RNA polymerases I- II-and III

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13198.1 1.000371485572848e-69
Description: RNA polymerase Rpb8 family protein (137 aa)
Oxytricha Contig19419.0.g46 0.00000000000007997998332353294
Description: RNA polymerase Rpb8
WormBase WBGene00017830 0.000000030002053728821195
Description: locus:rpb-8 Probable DNA-directed RNA polymerases I, II, and III subunit RPABC3 status:Confirmed UniProt:Q19826 protein_id:CCD65759.1
DictyBase DDB_G0278039 0.00000019998969434520019
Description: rpb8 on chromosome: 3 position 186227 to 187053
SGD YOR224C 0.000004000864880866421
Description: RPB8 RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00475220(coding)
ATGACAGATTTTACTAGCGATGCTATTTTAGTTGATGATACTTTCATAGCATCAAATATA
ATAAAAGAACCTAAATATGTTAGAACTTGGAGAGTAATTTTGAATAATGAAACATTATCA
ATCGAGATAGATATCAATTTTGATCTCTTCCCTATGGAACAAGACAAAAAATATTAGGTT
ATTCTCACTCAATCATTTTTACCAGAGTATAAAAAGAGCTTTTCTTATGCCATGTATGGA
AAGATATTTAAAATTGATTTAGAATAAGATTAATATTAAAGCATATATATTTCTTATGGA
GGTCTTGTTATGAAAATGAGAGGTAAATTAAATGATATGAGCTAAAGCATAAAAAATGAA
ACTCGTTGCTATATTTTACTAAGATAAATTTGA


>TTHERM_00475220(gene)
ATGACAGATTTTACTAGCGATGCTATTTTAGTTGATGATACTTTCATAGCATCAAATATA
ATAAAAGAACCTAAATATGTTAGAACTTGGAGAGTAATTTTGAATAATGAAACATTATCA
ATCGAGATAGATATCAATTTTGATCTCTTCCCTATGGAACAAGACAAAAAATATTAGGTT
ATTCTCACTCAATCATTTTTACCAGAGTATAAAAAGAGCTTTTCTTATGCCATGTATGGA
AAGATATTTAAAATTGATTTAGAATAAGATTAATATTAAAGCATATATATTTCTTATGGA
GGTCTTGTTATGAAAATGAGAGGTAAATTAAATGATATGAGCTAAAGCATAAAAAATGAA
ACTCGTTGCTATATTTTACTAAGATAAATTTGA


>TTHERM_00475220(protein)
MTDFTSDAILVDDTFIASNIIKEPKYVRTWRVILNNETLSIEIDINFDLFPMEQDKKYQV
ILTQSFLPEYKKSFSYAMYGKIFKIDLEQDQYQSIYISYGGLVMKMRGKLNDMSQSIKNE
TRCYILLRQI