Identifiers and Description

Gene Model Identifier

TTHERM_00476670

Standard Name

RPL20 (Ribosomal Protein of the Large subunit #20)

Aliases

PreTt06196 | 58.m00168 | 3719.m00028 | RPL18A

Description

RPL20 60S ribosomal protein L18a; Homolog of Yeast RPL20- Human RPL18A; Ribosomal L18ae protein family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01775 ) ribosomal L18ae protein family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14167.1 9.995516318087232e-125
Description: ribosomal L18ae protein family protein (191 aa)
Oxytricha Contig16734.0.g67 1.0004249259458435e-52
Description: Ribosomal L18ae/LX protein domain
WormBase WBGene00004432 7.997739975804982e-43
Description: locus:rpl-20 60S ribosomal protein L18a status:Confirmed UniProt:O44480 protein_id:CCD68709.1
DictyBase DDB_G0285881 2.0005131442217614e-40
Description: rpl18a on chromosome: 4 position 3775456 to 3776276
SGD YOR312C 9.9981864321491e-40
Description: RPL20B Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Ap and has similarity to rat L18a ribosomal protein
Stentor Coeruleus SteCoe_36250 1.2995814250075031e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00476670(coding)
ATGGTTAGAAAAGCTGCCCAAGAACCCAAGGATGACACCCTCTAAATGAAGGTCAGACAA
TACGTCGTCTCTGCTGCTAGACTTCCCATCGAATAGGGTACCAAGCCTGAAATTCTCTAA
ATGAGAGTCTTCGCTAGAGATGAAGTCCATGCTAAGACCAAATTCTGGTACAACATGAGA
AAGTTGAACAAGATTAAAAGATCTTAAGGTAGAATCCTCTCCGTTAACGAAATCTACGAA
AAGTCCCTCAACACCGTCAAGACCTACGGTATCGTTCTTAAGTACTAATCTAGAACTGCT
ATCCACAACATGTACAAGGAATACAGAGATGTCTCTTTAAACGGTGCTGTTTCTCAACTT
ATCTAAGATATGGCTGGTAACCACAGAGCTCAACCTGATACCATCCAAATTATCAGAACT
GCCACCCTTGAACCCAAGGACATTAAGAGACCTGCTACCCTCGCCATGAGAAACGCTGCT
CTTAAGTTCCCCATCGTCAAGACCATCCACAGACCCTCCGAAAAGAAATACAGAACTGTT
TACAAGGCCACCAGACCTACCACTTTCTAGTGA


>TTHERM_00476670(gene)
ATGGTTAGAAAAGCTGCCCAAGAACCCAAGGATGACACCCTCTAAATGAAGGTAGGACCA
GCTTTAAAAATAAAAAAATTTTAATTTCTTCATCAAGTATTTCTTCAGTCTTTGGTAGGA
AGGCATATCATGCTCACCTGACTACCTCATGCTCCTTATTAACTTTAAGAATGCATTTTT
ACACAACATCTCTCTTGGATTTATCAAAAAAAATAATAAGCAAATATTGCTTCAATTAGT
AATTTAACCCTATTAAATATTGCTATCATGTCCAAATCTAGCAACTTTTGAAAAAAATGA
AAAGCAAAGGAGAGGTTTTGCAATATTGGCATTACGCTTCTGATTTCATTCGATCAGAAA
TAACAAAAATAGTGTTCATTATTTGATAGGGAGAGATGGATGGAATTAATTAATAATTAA
TTGCATATTTAGAGAAATACTCAAAATAAAAAGACTGACTTGAATGAAATTAAGTTATCA
TATTTATAATTATTTATTATTAATCAAAAGGTCAGACAATACGTCGTCTCTGCTGCTAGA
CTTCCCATCGAATAGGGTACCAAGCCTGAAATTCTCTAAATGAGAGTCTTCGCTAGAGAT
GAAGTCCATGCTAAGACCAAATTCTGGTAAGATAAATTTAAGATAAATTCAGATTTAGTC
TTCAAAACGAATTAGTCAGAGAGAAAAATATTTTAAACCCATTAACAATCACAATCGTTC
ATTTGCTGTGAGAAAATAAATATACTGGATGGATTAAGCAAAAGGCATTATAGTACAATA
ATTTAAGGTTCTACAATAAAACATATTATCAGTGCAATCTATAAATCAATCAATCAACCA
CTGCATACTAATATATCTTCACTAATACAATATATAAATAAATAAATAAATAAATGAGTG
AGTGAGTGAGTTAGTGAATTAGCTGCATTAATAACAGCAAGCAACAATAAAAAAACAAAT
TCATTCTGTTAAATAAATCTAATAAAAATTTAAAAATTTTAATTAAAAAGTTGAATTAAC
TTAGGCTATAATTCTGCTCTTCTTTAATTAAATGCAAAAATTAGTTTTATGGCTAGGATA
CAAAAAAATTTAATAACCTTAACTTGTTAGAATAAATTTGATTAGATCAACATCATAGTT
TTAGCATTTATTTAAATAAATGAAGGAGCAAACAAACAAGTAAATTAATAAATAAATAAA
TCGATTGTGAAAATGGGAAAGGCTTAAAGTAAAAATAGTTAAAACAATAATATTTAGAAG
GATAGATATATTAATTTATGTAAAAAAAGATCTTAAATCAAAAAAAAATTCAGCGAAATC
AAGCAATATGGGTGAACATATTTAGTTGAAAATATTTATAAAGATAATCCTAAAATTATC
CTGATGAAAAGCAGCAAATATTTCATTTTTAAATATTTCAAAAAAAGCATAGCTTGTAAT
TAAAAAAAAATTATGGAAGCAATCAACAAAATAATTCCACTAATTCGATTTGACTGACAC
TCTTACAAATTCCATTAAATAAATAAATATTAAATATATTTTCTTTTTTAAATAGGTACA
ACATGAGAAAGTTGAACAAGATTAAAAGATCTTAAGGTAGAATCCTCTCCGTTAACGAAA
TCTACGAAAAGTCCCTCAACACCGTCAAGACCTACGGTATCGTTCTTAAGTACTAATCTA
GAACTGCTATCCACAACATGTACAAGGAATACAGAGATGTCTCTTTAAACGGTGCTGTTT
CTCAACTTATCTAAGATATGGCTGGTAACCACAGAGCTCAACCTGATACCATCCAAATTA
TCAGAACTGCCACCCTTGAACCCAAGGACATTAAGAGACCTGCTACCCTCGCCATGAGAG
TAATTTATCAATAATTTATTAAATTAAAAATTCTAATTGAGGACAAACAAAACTTTTCAT
ATTTTATATTTTTAAGAATTCTATTTCCATTTTAAATGAATTATATTGGATCTAATTTAT
TTTTAATGAGATATGTTTGTTTGTCTTTGATTTACTGAAAAAAATATGCTGTTAAAAAAA
ACTATTTATTAAAATTTATCTTCATAAAAATTTAGAACGCTGCTCTTAAGTTCCCCATCG
TCAAGACCATCCACAGACCCTCCGAAAAGAAATACAGAACTGTTTACAAGGCCACCAGAC
CTACCACTTTCTAGTGA


>TTHERM_00476670(protein)
MVRKAAQEPKDDTLQMKVRQYVVSAARLPIEQGTKPEILQMRVFARDEVHAKTKFWYNMR
KLNKIKRSQGRILSVNEIYEKSLNTVKTYGIVLKYQSRTAIHNMYKEYRDVSLNGAVSQL
IQDMAGNHRAQPDTIQIIRTATLEPKDIKRPATLAMRNAALKFPIVKTIHRPSEKKYRTV
YKATRPTTFQ