Identifiers and Description

Gene Model Identifier

TTHERM_00481220

Standard Name

KIN1 (KINesin)

Aliases

PreTt06254 | 58.m00226 | 3719.m00082

Description

KIN1 kinesin motor catalytic domain protein; Kinesin II heavy chain homolog; implicated in intraciliary transport; shares essential functions with KIN2 in ciliary assembly and maintenance- rotokinesis and phagocytosis; localizes to locomotory and oral cilia undergoing active assembly

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00225 ) Kinesin motor domain
  • ( TIGR00188 ) ribonuclease P protein component

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_30538 0
Description: None
Tetrahymena borealis EI9_14207.1 9.997093137033517e-262
Description: kinesin motor domain-containing protein (734 aa)
Oxytricha Contig740.0.g101 9.997093137033517e-262
Description: Kinesin motor domain
WormBase WBGene00002222 2.0004460046616782e-163
Description: locus:klp-11 status:Partially_confirmed UniProt:Q19633 protein_id:CAA92295.2
DictyBase DDB_G0280967 1.0002434920975502e-91
Description: kif3 on chromosome: 3 position 4109358 to 4113107
SGD YBL063W 1.999129405549486e-73
Description: KIP1 Kinesin-related motor protein required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:14983519: Awan A, Bernstein M, Hamasaki T, Satir P (2004) Cloning and characterization of Kin5, a novel Tetrahymena ciliary kinesin II. Cell motility and the cytoskeleton 58(1):1-9
  2. Ref:12925756: Brown JM, Fine NA, Pandiyan G, Thazhath R, Gaertig J (2003) Hypoxia regulates assembly of cilia in suppressors of Tetrahymena lacking an intraflagellar transport subunit gene. Molecular biology of the cell 14(8):3192-207
  3. Ref:10512852: Brown JM, Marsala C, Kosoy R, Gaertig J (1999) Kinesin-II is preferentially targeted to assembling cilia and is required for ciliogenesis and normal cytokinesis in Tetrahymena. Molecular biology of the cell 10(10):3081-96
  4. Ref:11212349: Cole DG (1999) Kinesin-II, the heteromeric kinesin. Cell Mol Life Sci 56(3-4):217-26
  5. Ref:10772758: Brown JM, Hardin C, Gaertig J (1999) Rotokinesis, a novel phenomenon of cell locomotion-assisted cytokinesis in the ciliate Tetrahymena thermophila. Cell biology international 23(12):841-8

Sequences

>TTHERM_00481220(coding)
ATGAGCAAATAAGAAAAAAATAGTAAAAATGATGAGTGTGTTAAGGTCGTCGTTAGATGT
AGACCTTTGAACTCAAAGGAAAAAGAAGATGGAAGAACATAAGTAGTATTTGTAAATTAA
TCAAGAGGTGAAATTTCAGTCACAAACCCAAAAGGTGATTCAGCTGAAGCACCTAAAGTA
TTTACTTTTGATTCCACATTTGAACCTGAAGTTGAATAAGAAACTGTTTACAAAAATACT
GCATATCCAATTGTTGAAAGTGTTCTTGAGGGTTATAATGGAACTATTTTTGCATATGGT
CAAACTGGTACAGGTAAAACCCATACTATGGAAGGTAAAGATGAACCTAAACATTTAAGA
GGTATCATTCCTAGAACTTTCGACCATATTTTCCGTTCAATTAAGGGAACTCCAAACGTA
CAGTTTTTAGTTAGAGTTAGTTTTCTTGAATTGTACAATGAAGAAATTAGAGATCTACTT
TAGAAGAATATCAAAAAGTTAGAATTGAGAGAAAAACCAGGCAGTGGTGTTTATGTAAAA
GATTTGTCTACTTTTATGATTTAAGATTAAGAAGAATTGAGAGAAAAATTATTACATGGT
CGTGAAAATCGTGCTGTAGGAGCTACTTAAATGAATCAAGATTCTTCACGTTCTCACTCT
ATTTTTGCAATTACTATTGAAAGATGCGATATTGTTAATGGTGAAAGCCACATTAGAGTC
GGTAAGTTAAATCTTGTCGATCTTGCTGGTTCTGAACGTTAGAGTAAAACTCAAGCTACT
GGTTCTAGACTAAAAGAAGCCATTAATATTAACTAAAGTTTAACAACTCTAGGTAACGTT
ATCTCCTCTCTTATCGATCCTAAAGCTACCCACGTTCCTTATAGAGATTCTAAATTAACA
AGACTTCTTTAAGATTCACTTGGTGGTAACACTAAAACTGTTATGGTTGCTAACGTTGGT
CCTGCCGACTTTAACTATGATGAAACTATTTCAACTTTGAGATATGCCCACAGAGCTAAA
TCCATTTAGAATCATGCTAAAATTAATGAAGATCCTAAAGATGCTATGATTAGATAGTTT
TAAGAAGAAATTGCTAAGTTGAAATAACAATTAGCCAGTTCAGTTGATAAAGATGGAAAT
ATTGTCATGATGGAAGCAGAAGTCATCTAGGTTGAAAAAGTCATTACTATTAATGATGAT
GAAAAGGTCAAGCTTTTATAGCAAAAGTTAGAGCAAGAAAAGTCTGAAGTTGAGAAGAAG
TATTAGAATGAAGTAAAGAAGATTGAAGAAGATAAAAAACTTTAAGAAAAAGAAAAGCAA
CAACTTCTCTAACAACTTATGGATAAAGAAGAAAGAGAATAGAAGTAGAGAGAACAACAA
GAAAAATTGCTTAAAAAATTATAAAAAATGTAAGAAAAAGTTATTTAAGGAGATGAAATT
ATGTAAAAGGCTCTTGAAAAAGAAAGAGAATTAAATAAAGCCCAGCAAGAATTGCAACAA
AGAAAGGAAAGAGACCGTTAAATAGCTGAATAAATTAAAAGAAATGAAGATTTGGCTTTA
GAAATTAATTAAAAATATAGAAGTTAAGCAGAAGAAGCTTAGGATAAAACAAAAAGAATA
AAAGCATTGGTTGGTAGACTTAAATAAATTGAAAGTGAAAACAGAGAACTCGATGATTTC
TATGGTTCTGAAATAGAATAACTCTAAGAAAGACGTAGAGATTTGTAAAAAGAACTCAAG
TTAAAGAATTTAATACTTGAATATTTCATTCCTGAAAAAGAGTTAGAAAGATTATAATTA
AGAGCAATGTATAATGAAGAGCTAGATGAATGGATGTATCCTTACTTACACCTGGCTGGA
AATTTAGTTAGAAATTCAGAAGAAAGAAAATAATAAGAATAAGAGATTAAATTTTAAGAA
GATGTTGAAGAAATTCTTAAACTAGAAGAAGAAGGTCATCCAAATGTATTCTTTGTATAC
ACTGAAGAAGGACCAGTTCGTGAAGATGACATAGACCCAGAGCAAAGAAAAAAGAAAGCA
GTTGCACAAGCTAGAAAATAAAGTGCCAAAAAACGTCCAACTTCAAAGCCAGGGTAATCA
GCTACATCAAAAAGACCATAAAGCGGTGTTAAAAATTCAAATAACAGCTCTTCTGTTACA
GCTGACTCTGATAATTACCCCAAAGCAAAAGGATTATAACCTAAAAAGTGA


>TTHERM_00481220(gene)
ATGAGCAAATAAGAAAAAAATAGTAAAAATGATGAGTGTGTTAAGGTCGTCGTTAGATGT
AGACCTTTGAACTCAAAGGAAAAAGAAGATGGAAGAACATAAGTAGTATTTGTAAATTAA
TCAAGAGGTGAAATTTCAGTCACAAACCCAAAAGGTGATTCAGCTGAAGCACCTAAAGTA
TTTACTTTTGATTCCACATTTGAACCTGAAGTTGAATAAGAAACTGTTTACAAAAATACT
GCATATCCAATTGTTGAAAGTGTTCTTGAGGGTTATAATGGAACTATTTTTGCATATGGT
CAAACTGGTACAGGTAAAACCCATACTATGGAAGGTAAAGATGAACCTAAACATTTAAGA
GGTATCATTCCTAGAACTTTCGACCATATTTTCCGTTCAATTAAGGGAACTCCAAACGTA
CAGTTTTTAGTTAGAGTTAGTTTTCTTGAATTGTACAATGAAGAAATTAGAGATCTACTT
TAGAAGAATATCAAAAAGTTAGAATTGAGAGAAAAACCAGGCAGTGGTGTTTATGTAAAA
GATTTGTCTACTTTTATGATTTAAGATTAAGAAGAATTGAGAGAAAAATTATTACATGGT
CGTGAAAATCGTGCTGTAGGAGCTACTTAAATGAATCAAGATTCTTCACGTTCTCACTCT
ATTTTTGCAATTACTATTGAAAGATGCGATATTGTTAATGGTGAAAGCCACATTAGAGTC
GGTAAGTTAAATCTTGTCGATCTTGCTGGTTCTGAACGTTAGAGTAAAACTCAAGCTACT
GGTTCTAGACTAAAAGAAGCCATTAATATTAACTAAAGTTTAACAACTCTAGGTAACGTT
ATCTCCTCTCTTATCGATCCTAAAGCTACCCACGTTCCTTATAGAGATTCTAAATTAACA
AGACTTCTTTAAGATTCACTTGGTGGTAACACTAAAACTGTTATGGTTGCTAACGTTGGT
AATTTATTTTAAACTAATAAAAATTTTTAAAAAGAAATAATCCTCTTTAAGATTAAATTA
ACACATTTAATAATAAAAATGGATAATTGAGAATTTCAAAATTAAATTTCATTTGTTAAT
CGTAAAAAAAACTAATTATTTAAATGTATTTTTATAAAATATTAATTAATAAATAATAAA
TTTTAAAAAATTAAAGGTCCTGCCGACTTTAACTATGATGAAACTATTTCAACTTTGAGA
TATGCCCACAGAGCTAAATCCATTTAGAATCATGCTAAAATTAATGAAGATCCTAAAGAT
GCTATGATTAGATAGTTTTAAGAAGAAATTGCTAAGTTGAAATAACAATTAGCCAGTTCA
GTTGATAAAGATGGAAATATTGTCATGATGGAAGCAGAAGTCATCTAGGTATTTATTTTA
AATTTAAAAATAAAAACAATTTAACAATTTAATAAAAATGTTTATTTATTTACTTTTAAT
TTAAATTTTAGGTTGAAAAAGTCATTACTATTAATGATGATGAAAAGGTCAAGCTTTTAT
AGCAAAAGTTAGAGCAAGAAAAGTCTGAAGTTGAGAAGAAGTATTAGAATGAAGTAAAGA
AGATTGAAGAAGATAAAAAACTTTAAGAAAAAGAAAAGCAACAACTTCTCTAACAACTTA
TGGATAAAGAAGAAAGAGAATAGAAGTAGAGAGAACAACAAGAAAAATTGCTTAAAAAAT
TATAAAAAATGTAAGAAAAAGTTATTTAAGGAGATGAAATTATGTAAAAGGCTCTTGAAA
AAGAAAGAGAATTAAATAAAGCCCAGCAAGAATTGCAACAAAGAAAGGAAAGAGACCGTT
AAATAGCTGAATAAATTAAAAGAAATGAAGATTTGGCTTTAGAAATTAATTAAAAATATA
GAAGTTAAGCAGAAGAAGCTTAGGATAAAACAAAAAGAATAAAAGCATTGGTTGGTAGAC
TTAAATAAATTGAAAGTGAAAACAGAGAACTCGATGATTTCTATGGTTCTGAAATAGAAT
AACTCTAAGAAAGACGTAGAGATTTGTAAAAAGAACTCAAGTTAAAGAATTTAATACTTG
AATATTTCATTCCTGAAAAAGAGTTAGAAAGATTATAAGTATGTTTTTTTCATTTTTTAA
TTCAAATTTTTATTAACTTCGATATAAATTTAAATAGTTAAGAGCAATGTATAATGAAGA
GCTAGATGAATGGATGTATCCTTACTTACACCTGGCTGGAAATTTAGTTAGAAATTCAGA
AGAAAGAAAATAATAAGAATAAGAGATTAAATTTTAAGAAGATGTTGAAGAAATTCTTAA
ACTAGAAGAAGAAGGTCATCCAAATGTATTCTTTGTATACACTGAAGAAGGACCAGTTCG
TGAAGATGACATAGACCCAGAGCAAAGAAAAAAGAAAGCAGTTGCACAAGCTAGAAAATA
AAGTGCCAAAAAACGTCCAACTTCAAAGCCAGGGTAATCAGCTACATCAAAAAGACCATA
AAGCGGTGTTAAAAATTCAAATAACAGCTCTTCTGTTACAGCTGACTCTGATAATTACCC
CAAAGCAAAAGGATTATAACCTAAAAAGTGA


>TTHERM_00481220(protein)
MSKQEKNSKNDECVKVVVRCRPLNSKEKEDGRTQVVFVNQSRGEISVTNPKGDSAEAPKV
FTFDSTFEPEVEQETVYKNTAYPIVESVLEGYNGTIFAYGQTGTGKTHTMEGKDEPKHLR
GIIPRTFDHIFRSIKGTPNVQFLVRVSFLELYNEEIRDLLQKNIKKLELREKPGSGVYVK
DLSTFMIQDQEELREKLLHGRENRAVGATQMNQDSSRSHSIFAITIERCDIVNGESHIRV
GKLNLVDLAGSERQSKTQATGSRLKEAININQSLTTLGNVISSLIDPKATHVPYRDSKLT
RLLQDSLGGNTKTVMVANVGPADFNYDETISTLRYAHRAKSIQNHAKINEDPKDAMIRQF
QEEIAKLKQQLASSVDKDGNIVMMEAEVIQVEKVITINDDEKVKLLQQKLEQEKSEVEKK
YQNEVKKIEEDKKLQEKEKQQLLQQLMDKEEREQKQREQQEKLLKKLQKMQEKVIQGDEI
MQKALEKERELNKAQQELQQRKERDRQIAEQIKRNEDLALEINQKYRSQAEEAQDKTKRI
KALVGRLKQIESENRELDDFYGSEIEQLQERRRDLQKELKLKNLILEYFIPEKELERLQL
RAMYNEELDEWMYPYLHLAGNLVRNSEERKQQEQEIKFQEDVEEILKLEEEGHPNVFFVY
TEEGPVREDDIDPEQRKKKAVAQARKQSAKKRPTSKPGQSATSKRPQSGVKNSNNSSSVT
ADSDNYPKAKGLQPKK