Identifiers and Description

Gene Model Identifier

TTHERM_00481300

Standard Name

EPI35 (EPIplasmic protein 35)

Aliases

PreTt06262 | 58.m00234 | 3719.m00090

Description

hypothetical protein; Epiplasmic protein; localizes to basal bodies

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14216.1 5.998305401373361e-129
Description: hypothetical protein (328 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00481300(coding)
ATGTCCTCAAACGAAAACCAATCTGAACAAGAAAAAGCTTAAGTCTTACAAGGAACTAAG
CCTGTCTACTAATACCCTGCTTATACTAGCTAATACGTCTAATAATAGCCTTTGATTTAA
TCTTAATTGGTTACTCAACCCGTATAATATGTTTAGCAACCAGTTTAATATGTCTAATAA
ACTGTTTAAGGAGTTCATTAATCTGCCCTTTCTCAATCCCAAGCTGTTGCTTCTGGCCTT
GTTGCAACCTAAATTCAAAGAGAAGTTGTCAAGGGTGAATCCAGAATTGAATACATTCCT
TATGAAAAATCTGTGATCGAATATGAAGCCGTTCAAAGAGTTGATTACGTTCCCAAGGAA
AAGAAAATCACTGATTACTACGCCGTTGAATATTAAACTGAGTACCTTCCTCAAGTTTAC
TAAGACAGATATATTGAATACATTCCCACTGAAAGAATCTAAGAAAGAGTTGAATATCAA
GCAATTCAAAAGCAAATAGTTCACCAACCTGTTTAACAATAATAATAAGTTCTTTAAACC
GTTGTCCAACCTGCTACCACCTACCTCTAATCTTCTCAAGTCACTGTCCCTGTAGTATAA
TAACAATTCGTTCCTACTGCTTCTGTTGTCCACACTACTATCCCTGCCACTCAAGTCGTC
CAAGGTGCTACTCATGTTGTCCAAGGAGCTTCTACTGTTGTTTAAAACGTTCCAACTGCA
TAGTTTGTTTAAACTGTCCCCACTGCCTTCTCAACTCAAACCTTAGGTGTCCCCGTTGTT
CGTGCTGGTTTGACTACCTCTGGTGTTAGAACCTTAGGACCTGTTCCTTACTCAGTTGTA
GAAGAAGCTATTAAGAAAAGCTAAAAGAAGGACGAATGA


>TTHERM_00481300(gene)
ATGTCCTCAAACGAAAACCAATCTGAACAAGAAAAAGCTTAAGTCTTACAAGGAACTAAG
CCTGTCTACTAATACCCTGCTTATACTAGCTAATACGTCTAATAATAGCCTTTGATTTAA
TCTTAATTGGTTACTCAACCCGTATAATATGTTTAGCAACCAGTTTAATATGTCTAATAA
ACTGTTTAAGGAGTTCATTAATCTGCCCTTTCTCAATCCCAAGCTGTTGCTTCTGGCCTT
GTTGCAACCTAAATTCAAAGAGAAGTTGTCAAGGGTGAATCCAGAATTGAATACATTCCT
TATGAAAAATCTGTGATCGAATATGAAGCCGTTCAAAGAGTTGATTACGTTCCCAAGGAA
AAGAAAATCACTGATTACTACGCCGTTGAATATTAAACTGAGTACCTTCCTCAAGTTTAC
TAAGACAGATATATTGAATACATTCCCACTGAAAGAATCTAAGAAAGAGTTGAATATCAA
GCAATTCAAAAGCAAATAGTTCACCAACCTGTTTAACAATAATAATAAGTTCTTTAAACC
GTTGTCCAACCTGCTACCACCTACCTCTAATCTTCTCAAGTCACTGTCCCTGTAGTATAA
TAACAATTCGTTCCTACTGCTTCTGTTGTCCACACTACTATCCCTGCCACTCAAGTCGTC
CAAGGTGCTACTCATGTTGTCCAAGGAGCTTCTACTGTTGTTTAAAACGTTCCAACTGCA
TAGTTTGTTTAAACTGTCCCCACTGCCTTCTCAACTCAAACCTTAGGTGTCCCCGTTGTT
CGTGCTGGTTTGACTACCTCTGGTGTTAGAACCTTAGGACCTGTTCCTTACTCAGTTGTA
GAAGAAGCTATTAAGAAAAGCTAAAAGAAGGACGAATGA


>TTHERM_00481300(protein)
MSSNENQSEQEKAQVLQGTKPVYQYPAYTSQYVQQQPLIQSQLVTQPVQYVQQPVQYVQQ
TVQGVHQSALSQSQAVASGLVATQIQREVVKGESRIEYIPYEKSVIEYEAVQRVDYVPKE
KKITDYYAVEYQTEYLPQVYQDRYIEYIPTERIQERVEYQAIQKQIVHQPVQQQQQVLQT
VVQPATTYLQSSQVTVPVVQQQFVPTASVVHTTIPATQVVQGATHVVQGASTVVQNVPTA
QFVQTVPTAFSTQTLGVPVVRAGLTTSGVRTLGPVPYSVVEEAIKKSQKKDE