Identifiers and Description

Gene Model Identifier

TTHERM_00483410

Standard Name

CTH91 (CaTHepsin 91)

Aliases

PreTt06275 | 58.m00247 | 3719.m00101

Description

CTH91 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04244.1 3.000712232670428e-104
Description: papain family cysteine protease containing protein (328 aa)
Oxytricha Contig322.1.g116 3.000969471571755e-58
Description: Papain family cysteine protease
DictyBase DDB_G0283867 3.000458792073453e-56
Description: cprC on chromosome: 4 position 1092858 to 1094270
WormBase WBGene00000776 1.0000844672813518e-48
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_8145 1.2995814250075031e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00483410(coding)
ATGAAAATTGTCTTCGGAACTTGCATATTATTAATATTGACTAGTCTTATTGGACTAGGC
TATCTTAACAACCAATCTACACCTTTAAGCCAACTTATCAAAATAAAACCTTAATTTGAA
CATTTCAAGAGTAGATATAACTTACAATTCGATAATAACTAGGAAGAATAATATAGATTA
ATTATATTCCATGAAAATCTCAAACAAATTGAGCAAGACAATAATGATTCTGACAATGGA
TTTGTTTCTGGTGTTAATAAATTTTCACATTTAACTGAAGAAGAATTCAAAGCTAAATAT
TTGAATCGTCGTTAAAGATCTGCTTAAAACTTTTAAAACTATCCAATTCTTTCTTCATAA
AAAAACACTAATGAAAAACTACCAGAAAGTGTAGATTGGAGAAAATAAGGTGCAGTGTCA
CCTGTTAGAGATCAAGGCAATTGTGGTTGCTGTTATGCCATCACCTCTGCAGGAGCTCTT
GAAGGCTTGCATAAAATCAAGACAGGAAAGCTAGAAATCTTTTCTCCTTAATACATTATT
GATTGTTCTAATGGATAGTTTGATAATGCAGGATGTGATGGAGGTACTTCTGCCGGTGTA
TTTTAATTTGTATAAAAACATGGTATCAATTTAGAATCAAGATATCCTTATTAAGATAAA
TAAAATAAGAAATGTTTGAACAAAGAAACTATCTCATTTATTAATGGTTTCAAAGAAATT
CCTAAAGGAGACTGTAAAGAAATAGAGAGAGTTCTTTCTAAACAACCTGTCTCTATTTCT
ATAGATGCTAGAAAATTAAAAAATTATTAATCAGGTATTCTTAAACAATGCTCTAAAAAA
ATTAATTTAGATCATGAGATTTTAGCTGTAGGCTATACTCCTGACTATTTCATCTTAAAA
AATTCCTGGGGAACTGATTGGGGTATTGATGGATACTTCCATGTTTCTAAAGATAATACT
TGTGGTACTTGCGATGATGCTGCTTATCCTACATTGTGA


>TTHERM_00483410(gene)
ATGAAAATTGTCTTCGGAACTTGCATATTATTAATATTGACTAGTCTTATTGGACTAGGC
TATCTTAACAACCAATCTACACCTTTAAGCCAACTTATCAAAATAAAACCTTAATTTGAA
CATTTCAAGAGTAGATATAACTTACAATTCGATAATAACTAGGAAGAATAATATAGATTA
ATTATATTCCATGAAAATCTCAAACAAATTGAGCAAGACAATAATGATTCTGACAATGGA
TTTGTTTCTGGTGTTAATAAATTTTCACATTTAACTGAAGAAGAATTCAAAGCTAAATAT
TTGAATCGTCGTTAAAGATCTGCTTAAAACTTTTAAAACTATCCAATTCTTTCTTCATAA
AAAAACACTAATGAAAAACTACCAGAAAGTGTAGATTGGAGAAAATAAGGTGCAGTGTCA
CCTGTTAGAGATCAAGGCAATTGTGGTTGCTGTTATGCCATCACCTCTGCAGGAGCTCTT
GAAGGCTTGCATAAAATCAAGACAGGAAAGCTAGAAATCTTTTCTCCTTAATACATTATT
GATTGTTCTAATGGATAGTTTGATAATGCAGGTATTACAACATTTATAAATTTATATATT
TAATTATTAATTTATTTTCAACTAAATGTTATTAAAGGATGTGATGGAGGTACTTCTGCC
GGTGTATTTTAATTTGTATAAAAACATGGTATCAATTTAGAATCAAGGTAAAAAATGTTT
TAAAAGATATTATTTAAAATAAAATGAAATAAATATTTAAATAAAATAATAAAAAATTAC
TGAAATGGTTGATTTAAATTAGAAAGAAAAATATTTTGGAATTTGAGTTAATCTAAAAAT
AACTTGTTAAAAAAATATTAAAGAAAAAAATCAATTAAAAATAAAGAAAAATTATGAATT
GTTTTAGAAACAAAATATTCATCAAAAAAGCTTGTAAAATAAATACTTTAACTAATTTTT
ATCTTAAAAAATACTTAGATATCCTTATTAAGATAAATAAAATAAGAAATGTTTGAACAA
AGAAACTATCTCATTTATTAATGGTTTCAAAGAAATTCCTAAAGGAGACTGTAAAGAAAT
AGAGAGAGTTCTTTCTAAACAACCTGTCTCTATTTCTATAGATGCTAGAAAATTAAAAAA
TTATTAATCAGGTATTCTTAAACAATGCTCTAAAAAAATTAATTTAGATCATGAGATTTT
AGCTGTAGGCTATACTCCTGACTATTTCATCTTAAAAAATTCCTGGGGAACTGATTGGGG
TATTGATGGATACTTCCATGTTTCTAAAGATAATACTTGTGGTACTTGCGATGATGCTGC
TTATCCTACATTGTGA


>TTHERM_00483410(protein)
MKIVFGTCILLILTSLIGLGYLNNQSTPLSQLIKIKPQFEHFKSRYNLQFDNNQEEQYRL
IIFHENLKQIEQDNNDSDNGFVSGVNKFSHLTEEEFKAKYLNRRQRSAQNFQNYPILSSQ
KNTNEKLPESVDWRKQGAVSPVRDQGNCGCCYAITSAGALEGLHKIKTGKLEIFSPQYII
DCSNGQFDNAGCDGGTSAGVFQFVQKHGINLESRYPYQDKQNKKCLNKETISFINGFKEI
PKGDCKEIERVLSKQPVSISIDARKLKNYQSGILKQCSKKINLDHEILAVGYTPDYFILK
NSWGTDWGIDGYFHVSKDNTCGTCDDAAYPTL