Identifiers and Description

Gene Model Identifier

TTHERM_00483490

Standard Name

IBD2 (Interactive BromoDomain Protein 2)

Aliases

PreTt06283 | 58.m00255 | 3719.m00109 | Brop-6

Description

bromodomain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14230.1 3.0001680331469735e-143
Description: bromodomain containing protein (231 aa)
Oxytricha Contig18584.0.g108 2.00017271388466e-38
Description: Bromodomain
DictyBase DDB_G0293800 3.9992896861436003e-19
Description: DDB_G0293800 on chromosome: 6 position 3334534 to 3337072
Stentor Coeruleus SteCoe_3545 3.1391327920480296e-17
Description: None
WormBase WBGene00017423 4.0002685161515803e-16
Description: status:Confirmed UniProt:O76561 protein_id:CCD69431.1
SGD YDL070W 0.00000000000001000191320216021
Description: BDF2 Protein involved in transcription initiation at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00483490(coding)
ATGTCAGCAAAAATAAAATCTACTTTAAAGTTTGTCACGGAAACATCAACCAGAAAAGAA
GATTATAAAAAAATGAATACAGTATTATAATCACTATTTGATAATAGCGACTCTCTAGAG
TTTAGATAACCTGTGGATTACTTAGCTTTAGGATTAACTGACTATCCAAATGTGGTTAAA
AAGCCAATGGACTTATCTACTGTTAAAAATAAAATAAATACACAAAGTTATGACACAATA
GAAGACTTTTTAGATGATATTTAATTAATTTGGGATAATTGTAAATTATATAATGCTTAA
GGATCTTGGATTTGGAAGTTAGCAGATAAATTAGACAAGTACTATAAAAAGCTTATAAAA
AATTATTTGCCTATGGTCCAAGTTCAATAAACAGTTGGAAAAAAAGAGAAGAAAGATGAT
AAAGCAAGCAAATAATAAGATGTGTATATTGATAATTTTTAAGAAGAAAAAAGCTCATTT
ACTGCTAAAATTAAATAACTTACAGAAGAATAGTTAGGTAGTATAGTAGAATAAATTAGA
TTAGAAAATCCTTAAGCATTTATAAGATTAGATAATAAAAAGTTATAAGTTATTGTTGAT
AGCATCAGTTTTGAATCTTTATAAAATTATAATACTTAAATCGATAACTGGTTAATCCCT
GTTAAGACTACAAATAAAAGAAGTAAAAATAATTGA


>TTHERM_00483490(gene)
ATGTCAGCAAAAATAAAATCTACTTTAAAGTTTGTCACGTAATTAGTTAAGCTTATAGTT
AGAGTTGTTAGGAATGACTAAAGCATAATTCTATTTAGAAATTGACATTCACAATTTAAA
AAGGCGTTATCGAAGTTAATATTTATTAATTATTTTCAAAAGGGAAACATCAACCAGAAA
AGAAGATTATAAAAAAATGAATACAGTATTATAATCACTATTTGATAATAGCGACTCTCT
AGAGTTTAGATAACCTGTGGATTACTTAGGTAAAACGTTTACTTCATTAGAATATGCTTT
TTTAACTTTTAATCAATAAAATTTAGCTTTAGGATTAACTGACTATCCAAATGTGGTTAA
AAAGCCAATGGACTTATCTACTGTTAAAAATAAAATAAATACACAAAGTTATGACACAAT
AGAAGACTTTTTAGATGATATTTAATTAATTTGGGATAATTGTAAATTATATAATGCTTA
AGGATCTGTAAATATTTTATTTATTAAGATACTTATAAACAAATATGATTAGTTATCGAT
ACATAAATATATGTAAATCTTTTAAATAATTCATTTAATTATTAACAGTGGATTTGGAAG
TTAGCAGATAAATTAGACAAGTACTATAAAAAGCTTATAAAAAATTATTTGCCTATGGTC
CAAGTTCAATAAACAGTTGGAAGTAAATTAATTTACATATTTACTAAATATTGATCGATG
ATAAATTTTTAAAATTAAAATATTAGAAAAAGAGAAGAAAGATGATAAAGCAAGGTAAAC
TTAATTTTTTGAATGAGATAATGAACAAAGAATTTTTAAAAGAAAGATAATGAAATTGAT
TAATCTTTTTTATTAAGGTATTTTAATGAGCTAAAATATTTTTTATAAATTAGCAAATAA
TAAGATGTGTATATTGATAATTTTTAAGAAGAAAAAAGCTCATTTACTGCTAAAATTAAA
TAACTTACAGAAGAATAGTTAGGTAGTATAGTAGAATAAATTAGATTAGAAAATCCTTAA
GCATTTATAAGATTAGATAATAAAAAGTTATAAGTTATTGTTGATAGCATCAGTTTTGAA
TCTTTATAAAATTATAATACGTAAATTTTGAATATTTTTTGAAAACCTATTGAAATTATT
TCTATAAAAATAGTTAAATCGATAACTGGTTAATCCCTGTTAAGACTACAAATAAAAGAA
GTAAAAATAATTGA


>TTHERM_00483490(protein)
MSAKIKSTLKFVTETSTRKEDYKKMNTVLQSLFDNSDSLEFRQPVDYLALGLTDYPNVVK
KPMDLSTVKNKINTQSYDTIEDFLDDIQLIWDNCKLYNAQGSWIWKLADKLDKYYKKLIK
NYLPMVQVQQTVGKKEKKDDKASKQQDVYIDNFQEEKSSFTAKIKQLTEEQLGSIVEQIR
LENPQAFIRLDNKKLQVIVDSISFESLQNYNTQIDNWLIPVKTTNKRSKNN