Identifiers and Description

Gene Model Identifier

TTHERM_00483640

Standard Name

TCDK3 (Tetrahymena Cyclin-Dependent Kinase 3)

Aliases

PreTt06298 | 58.m00270 | 3719.m00124

Description

TCDK3 cyclin-dependent kinase-like Serine/Threonine kinase family protein; Protein kinase domain containing protein; sequence similarity to the CDC2 subfamily of the protein kinase CDK family; essential for the initiation of meiosis

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14244.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (313 aa)
Oxytricha Contig5189.0.g91 9.996050283847121e-108
Description: Protein kinase domain
DictyBase DDB_G0272813 1.999745369828301e-106
Description: cdk1 on chromosome: 2 position 2216835 to 2217926
WormBase WBGene00000405 5.002432061182517e-99
Description: locus:cdk-1 Cyclin-dependent kinase 1 status:Confirmed UniProt:P34556 protein_id:CAA81590.1
SGD YBR160W 9.99583921019208e-96
Description: CDC28 Catalytic subunit of the main cell cycle cyclin-dependent kinase (CDK); alternately associates with G1 cyclins (CLNs) and G2/M cyclins (CLBs) which direct the CDK to specific substrates
Stentor Coeruleus SteCoe_19115 2.2856936767186716e-49
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27420775: Yan GX, Zhang J, Shodhan A, Tian M, Miao W (2016) Cdk3, a conjugation-specific cyclin-dependent kinase, is essential for the initiation of meiosis in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(18):2506-14
  2. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00483640(coding)
ATGGAAAACTTAGAAAATTTGGAAACTATTGAAGACAGGTACTAAAAGATCAAAAAAATA
GGAGAAGGTACATACGGAAAAGTATTCTAAGCGAAAGATTTAAAAACTGATTAAATAGTA
GCCTTAAAGAAAGTGAAGAATGACTATGAAGAAATTGGTGACGAAGGTATTCCTTCAACA
GCTCTCAGAGAAATTTCTTGCTTAAAAGCACTGGATCATCCTAATGTGGTTAAATTGGTT
GACGTTGTTTACATTATGAAAAAGAATAAGCTTTATCTTGTTTTTGAATACATAGACTAC
GATCTAAAAGCATATCAGAAAAAAATTGGAAAAATACCTGAGCAGACAGTAAAGTCGTAC
ATGCACCAGATCTTAAAAGGGATTGAGCATTGCCATTCTAGGAGAATATTTCATAGAGAT
TTGAAGCCTTAAAATATATTAGTTAATAACAAGGGTGATATTAAGATTGCAGATTTTGGC
CTTGGCAAAATATTTGGAATCCCTCTTAACACTATCACTCATGAAGTAGAAACTCTATGG
TACAGAGCTCCTGAGATACTTTTAGGTGATAAACTTTATTCGCTCCCTGTTGATGTTTGG
TCTATAGGGTGTATATTTGCTGAGTTGATTATAGGTCATCCTCTTTTTCATGGAGATAGT
GAAATTGATTAGATTTTCAAAATATTTTAGTTTTTTGGCACTCCAAAATCTTCAAAGTTA
GAAGGCACTTATAATTTAAAATATTGGTCAAATCTATTTCCACGCTTTAAATCCTAAAAA
GATGAAATTTTAAAGCCAATAATTGAGACCGATCCTCAAGCAGCTGATTTGCTAGTAAAG
TTAATAGACATTGAGCCTGCCAAGAGAATATCTGTGAGCCAGGCCTTAAAGCATCCTTAT
TTCGATAATATCTAATCACCATTGAACAGCTATATTTAATTTTTGATCAAAAAGACTGAC
TGA


>TTHERM_00483640(gene)
ATGGAAAACTTAGAAAATTTGGAAACTATTGAAGACAGGTACTAAAAGATCAAAAAAATA
GGAGAAGGTACATACGGAAAAGTATTCTAAGCGAAAGATTTAAAAACTGATTAAATAGTA
GCCTTAAAGAAAGTGAAGAATGACTATGAAGAAATTGGTGACGAAGGTATTCCTTCAACA
GCTCTCAGAGAAATTTCTTGCTTAAAAGCACTGGATCATCCTAATGTGGTTAAGTAATAA
ATAAATAAATAACTATAAAATTAGCATTATTTGTAAAATGATTTTACTTAAACAGATTGG
TTGACGTTGTTTACATTATGAAAAAGAATAAGCTTTATCTTGTTTTTGAATACATAGACT
ACGATCTAAAAGCATATCAGAAAAAAATTGGAAAAATACCTGAGCAGACAGTAAAGGTTT
GGTCATATTCTTTCTTTCAATAATACATTCATTCATCCATCCATCAATATATTCATTAAT
TGCTTTTTTGGAATTTTTATGATTTATTTTTTGATAAATGAATGATGCCTAAAATAATTT
AATTTAATTTAGTCGTACATGCACCAGATCTTAAAAGGGATTGAGCATTGCCATTCTAGG
AGAATATTTCATAGAGATTTGAAGCCTTAAAATATATTAGTTAATAACAAGGGTGATATT
AAGATTGCAGATTTTGGCCTTGGCAAAATATTTGGAATCCCTCTTAACACTATCACTCAT
GAAGTAGAAACTCTATGGTACAGAGCTCCTGAGATACTTTTAGGTGATAAACTTTATTCG
CTCCCTGTTGATGTTTGGTCTATAGGGTGTATATTTGCTGAGTTGATTATAGGTCATCCT
CTTTTTCATGGAGATAGTGAAATTGATTAGATTTTCAAAATATTTTAGTTTTTTGGCACT
CCAAAATCTTCAAAGTTAGAAGGCACTTATAATTTAAAATATTGGTCAAATCTATTTCCA
CGCTTTAAATCCTAAAAAGATGAAATTTTAAAGCCAATAATTGAGACCGATCCTCAAGCA
GCTGATTTGCTAGTAAAGTTAATAGACATTGAGCCTGCCAAGAGAATATCTGTGAGCCAG
GCCTTAAAGCATCCTTATTTCGATAATATCTAATCACCATTGAACAGCTGTAAATTTAAT
TAAATTAAAATAATAATTTCTGATAAATTAGTTAATTTGTAAATTTTTAATTATTCTAGA
GATATTTAATTTTTGATCAAAAAGACTGACTGA


>TTHERM_00483640(protein)
MENLENLETIEDRYQKIKKIGEGTYGKVFQAKDLKTDQIVALKKVKNDYEEIGDEGIPST
ALREISCLKALDHPNVVKLVDVVYIMKKNKLYLVFEYIDYDLKAYQKKIGKIPEQTVKSY
MHQILKGIEHCHSRRIFHRDLKPQNILVNNKGDIKIADFGLGKIFGIPLNTITHEVETLW
YRAPEILLGDKLYSLPVDVWSIGCIFAELIIGHPLFHGDSEIDQIFKIFQFFGTPKSSKL
EGTYNLKYWSNLFPRFKSQKDEILKPIIETDPQAADLLVKLIDIEPAKRISVSQALKHPY
FDNIQSPLNSYIQFLIKKTD