Identifiers and Description

Gene Model Identifier

TTHERM_00484731

Standard Name

RRM28 (RNA Recognition Motif-containing protein 28)

Aliases

3719.m00872

Description

RRM28 splicing factor u2af large subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR00332 ) desulfoferrodoxin ferrous iron-binding domain
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14252.2 9.997093137033517e-262
Description: hypothetical protein (596 aa)
Oxytricha Contig1218.1.g100 3.000842737734004e-34
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)
WormBase WBGene00006697 9.995528898049344e-31
Description: locus:uaf-1 status:Confirmed UniProt:Q8MXS2 protein_id:CCD62281.1
DictyBase DDB_G0286395 5.998760051700188e-30
Description: u2af2 on chromosome: 4 position 4405482 to 4407497
Stentor Coeruleus SteCoe_19768 0.00000000003775134544279098
Description: None
SGD YIL061C 0.00000030014504373857585
Description: SNP1 Component of U1 snRNP required for mRNA splicing via spliceosome; substrate of the arginine methyltransferase Hmt1p; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00484731(coding)
ATGAGTTTTCAAAATCAAGAAATTCACGATGACTTGAATGAAATGTAAAAGCTAACTGAA
GCATAGGAAGAACAATTCAAGCAACAAAATGACAATGACTATGATTAAGTAGGAACAAGT
GGTTATTAAGAAATAATCAAAAGATCAAGAGAAAATTCGATAGATTCAGCCCGTTCGCGC
TCAAGATCAATCAATGAAAGAAAGAGAAATTATAACAGATAGCAAAATAGCAACGAAGAA
GAGAGTCCAAAGATGGTCAATAAAGTAGAAGTACCTGTGATTAAGTTAGATAACTAATCA
GGATATCGTCACGCTAGACGTCTTTATATTGGTAACATTCCTGAAACTATTAATTAAGAA
TATCTAAGTGAATGGCTTTATCGTTCTCTTGAAGCAGCTGGAGGTCTTTAGCCTTCTTTG
CCCTCAGAAAATCCAATAGTAAAATGTGAAATTGATCCTAAAGGAAGGTTTGCATTTACT
GAGTTAAGGTCAATTGAAGAAACCACTGCTTTGCTTCAATTAGATGGAATTATTTTGTGG
CACAGATAATTAAGAATAAGAAGACCTACTGAATATGAAAAGTTCCCTAAGGTTCAAGGA
CAATTTGAAGCTAATATTCCCAAATTGAATTTCGATCTTTTCAAAACTGTTGGAATAGTA
ATTATTCCTACTATTGTTGATGATGGTCCTAACAAGATATTCTTGGCTAACTTGCCCACT
AAGATGGATGAGTTAATGATTTTAGATGAATTAAAACTTAGAGATATGGGTGAAATTAAA
GCATTCCATTTAGTTAAAGATAATCAAACTAACTAAAGTAAGGGATATGCCTTTTTTGAA
TTCAAAGATCCTTCTCTTACTGATAATTGTATAGAGACATTACATGGTATGCAATATGCT
GGTAGAACTCTTACATGCAAGAGATCTTAAATAGGAGGCTTAGGCAATAAATAAATGTCA
ACAGGAAACAATAAATAAAACAATAATAGAAATAGCAATCAGTAAAATAACTTAGGTGGT
AATAATAACATGCAAAGATAGAGTTTCTCTTCAGAAAATATTGATTCTATATAGGGATAA
AACTAATAAGGTATCAATGAAGGCAGTGGATTCTTTCCCAATTACTAATCAAACACACAA
GGTGGTGGAAATAACTAAAACAAGGGTATGAACTAAAATTATCAAAATAATGGCAATAAT
CATAACAACAATAATAAAAGAGGAAGAAACTTTGGAAATTAAAATAACTCAAATAACAAT
TACTACAATAATAATGGGGCAGGAATGAATAATGGTAATAACAATAATAATGGAAACAAT
AGAAGATTCTAAAATAACAACAATATGAATCACAATTAGTAAGGTTAGTTTACAAACGGA
GGAAATAAATTCAATAAAGGGCATGGTAACAACAACGGAATGAGTAACAAGAAGTAAAAT
TAATGGAACGGTTAGCAAAATAATTAAATCCCAAGCTAAGATAATTAAACTGGTATCTCC
TCTGATGGATATTATGAAGGAAGTAGTAGCTAAATTGGCTAATAATATGATGTTAGCTAA
ATGTACAACTATCAATAATCATAACAAGGATCTCATTATATGATGCAAGACTAATCTAAT
CCTTATTAATGA


>TTHERM_00484731(gene)
ATGAGTTTTCAAAATCAAGAAATTCACGATGACTTGAATGAAATGTAAAAGCTAACTGAA
GCATAGGAAGAACAATTCAAGCAACAAAATGACAATGACTATGATTAAGTAGGAACAAGT
GGTTATTAAGAAATAATCAAAAGATCAAGAGAAAATTCGATAGATTCAGCCCGTTCGCGC
TCAAGATCAATCAATGAAAGAAAGAGAAATTATAACAGATAGCAAAATAGCAACGAAGAA
GAGAGTCCAAGTAATATAAATCAAAATAGCAGGCCTGTTGCTTAGAGAAGCAATCATTTC
TTTGAGTAAAATGATGAATAGAATGAATAAAATTTAGGAGAAAATGATTTGAATAGTAAC
AACACAACTGGAGTTGATTTTAGTAAAATGAATTTCAACTAAAGTTTGTAATAACTTTAA
GAGATGGTCAATAAAGTAGAAGTACCTGTGATTAAGTTAGATAACTAATCAGGATATCGT
CACGCTAGGTATAATTTCATAGATTAATAAATTTACTAAATAACCACGGTATTTTCCTTC
CTGATTAATAAAAGCAGCTTTAATAACATAGCTCTGCTTTAATTGCATTAAGTAATGCTA
TTTTGCAGAAACATGTTGTTTTAAAGAGCATACTTTTGAAGCTGAAAGAAGAAAAAAAAC
TAAATAAATAACTTCGCCATAATATCAAAAGCAAACAAGCAAGAAAAAAAAACAAACAAA
CAAACAAACCTAATTTTCTTCCCCACTCTTTTTCAAATTTTTTCTCTTTACCATTTTTGT
AGCAATAAAAAAATCATCTTATTTTCTGTTTCTTTGATTTTTTATCATTGACCACCCCTC
ACAAATAATTTACAAAAAACTTTCTAATCCCCCTCCTTTCAATATTTTGCTTTGTATTAT
AAAGCAAAATCTATTTATCTATCTATCTAATCTTATCTCTCATTCATTCATTTATTCAAT
CTTTCTTCATTGATTCTTATTTTTTTTCTTTCTAATTTACCATGAATACATACTTATATT
ATATGTATATAATATTTTATAATCATATTATAATTAGCACCATACTTTATCATCAATAGC
AATTATTAAAAAATAAATCTTAATTTCTTTTCCTTCTTTTTCAATCAAATAAAGAATTTA
AAATTATTTTTTTCCCCCTCTTTTCTTCAATCTTTTTTTATTTATGACTGACCAAAAATT
AATTTTAAAAACTATATGCTACCTGTTTTTTCAAATATCTTCTTTTTCATTCTTTTTAAT
AGAAAAAGTCAACAAAAGAGAATTACATGATATTATACATTTATGAATCATCAAATATTT
TGTAGTATTTACTGCTTTCTCTCTTCTTTCTTCTTTTATTTTTTGCTTCTGCTCTAAATA
TTCATTCATTCATTTATTATTATTCTTCATATGTTATTTAATTTTACTTAAAATTGTTCA
TTTAAAATCATTTTAGTAGAAAAAGTATCTCTCCTTTACGTACCATTTAATTTTTTTAAA
ATTAGAAAGAAAACAAATAAACAAACATTCATATAAATAAACTAACTATTTACAGGATTG
ATTTAGGGTTGAAACAAATAAAAATAAACAAATAATAATGTATTATAAGTTGAGGGAAAG
ATCCGTATCACCTTCAAAGATATTTAAATAAAAAAAATCTTCTCATACAGTTTTAATATG
ATTCGATATCAATAGCTTTTTAATATTGCTATTTCGTGATATTTTTGAATTTAAATCAGG
AAAATATGCCGCTAATTTTAATATTTTTGAAATTTCATGAATTAATTAATTTAATTATAG
ACGTCTTTATATTGGTAACATTCCTGAAACTATTAATTAAGAATATCTAAGTGAATGGCT
TTATCGTTCTCTTGAAGCAGCTGGAGGTCTTTAGCCTTCTTTGCCCTCAGAAAATCCAGT
AAAAAATTTTATTAATAAATATTTCTAAAATTAAAAATATTATTTTTAACTTTATAAAAG
ATAGTAAAATGTGAAATTGATCCTAAAGGAAGGTTTGCATTTACTGAGTTAAGGTCAATT
GAAGAAACCACTGCTTTGCTTCAATTAGATGGAATTATTTTGGTAATAAAATAAACAATA
AAACATTTTATAATTTTAATTAATTAATTAATTAAAAAATTAGTGGCACAGATAATTAAG
AATAAGAAGACCTACTGAATATGAAAAGTTCCCTAAGGTTCAAGGACAATTTGAAGCTAA
TGTAATTAATTAATTTCAATTATTTTAATTATTTAATTTTACTTATTTAAAATAGATTCC
CAAATTGAATTTCGATCTTTTCAAAACTGTTGGAATAGTAATTATTCCTACTATTGTTGA
TGATGGTCCTAACAAGATATTCTTGGCTAACTTGCCCACTAAGATGGATGAGTTAATGAT
TTTAGATGAATTAAAACTTAGAGATATGGGGTAATAATTTACTTTTGATTATATATTTTA
AAACTTGTTAATTCATATTTTTTTGATTAAAACAGTGAAATTAAAGCATTCCATTTAGTT
AAAGATAATCAAACTAACTAAAGTAAGGGATATGCCTTTTTTGAATTCAAAGATCCTTCT
CTTACTGATAATTGTATAGAGACATTACATGGTATGCAATATGCTGGTAGAACTCTTACA
TGCAAGAGATCTTAAATAGGAGGCTTAGGCAATAAATAAATGTCAACAGGAAACAATAAA
TAAAACAATAATAGAAATAGCAATCAGTAAAATAACTTAGGTGGTAATAATAACATGCAA
AGATAGAGTTTCTCTTCAGAAAATATTGATTCTATATAGGGATAAAACTAATAAGGTATC
AATGAAGGCAGTGGATTCTTTCCCAATTACTAATCAAACACACAAGGTGGTGGAAATAAC
TAAAACAAGGGTATGAACTAAAATTATCAAAATAATGGCAATAATCATAACAACAATAAT
AAAAGAGGAAGAAACTTTGGAAATTAAAATAACTCAAATAACAATTACTACAATAATAAT
GGGGCAGGAATGAATAATGGTAATAACAATAATAATGGAAACAATAGAAGATTCTAAAAT
AACAACAATATGAATCACAATTAGTAAGGTTAGTTTACAAACGGAGGAAATAAATTCAAT
AAAGGGCATGGTAACAACAACGGAATGAGTAACAAGAAGTAAAATTAATGGAACGGTTAG
CAAAATAATTAAATCCCAAGCTAAGATAATTAAACTGGTATCTCCTCTGATGGATATTAT
GAAGGAAGTAGTAGCTAAATTGGCTAATAATATGATGTTAGCTAAATGTACAACTATCAA
TAATCATAACAAGGATCTCATTATATGATGCAAGACTAATCTAATCCTTATTAATGA


>TTHERM_00484731(protein)
MSFQNQEIHDDLNEMQKLTEAQEEQFKQQNDNDYDQVGTSGYQEIIKRSRENSIDSARSR
SRSINERKRNYNRQQNSNEEESPKMVNKVEVPVIKLDNQSGYRHARRLYIGNIPETINQE
YLSEWLYRSLEAAGGLQPSLPSENPIVKCEIDPKGRFAFTELRSIEETTALLQLDGIILW
HRQLRIRRPTEYEKFPKVQGQFEANIPKLNFDLFKTVGIVIIPTIVDDGPNKIFLANLPT
KMDELMILDELKLRDMGEIKAFHLVKDNQTNQSKGYAFFEFKDPSLTDNCIETLHGMQYA
GRTLTCKRSQIGGLGNKQMSTGNNKQNNNRNSNQQNNLGGNNNMQRQSFSSENIDSIQGQ
NQQGINEGSGFFPNYQSNTQGGGNNQNKGMNQNYQNNGNNHNNNNKRGRNFGNQNNSNNN
YYNNNGAGMNNGNNNNNGNNRRFQNNNNMNHNQQGQFTNGGNKFNKGHGNNNGMSNKKQN
QWNGQQNNQIPSQDNQTGISSDGYYEGSSSQIGQQYDVSQMYNYQQSQQGSHYMMQDQSN
PYQ