Identifiers and Description

Gene Model Identifier

TTHERM_00485800

Standard Name

TCT1A

Aliases

PreTt19512 | 59.m00150 | 3680.m00007 | Tctex1A

Description

TCT1A dynein light chain tctex-type 1 protein; Light chain subunit of ciliary three-headed outer arm dynein (OAD)- two-headed inner arm dynein (IAD) complex 1- and non-axonemal dynein complex 1

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12081.1 2.0009381340492598e-66
Description: tctex-1 family protein (110 aa)
DictyBase DDB_G0284589 9.997019043202629e-21
Description: dlcA on chromosome: 4 position 2178851 to 2179736
Stentor Coeruleus SteCoe_5962 0.00000000000009357622968840175
Description: None
Oxytricha Contig10748.0.g6 0.00000000000020009182674645818
Description: Tctex-1 family
WormBase WBGene00008764 0.0000000010002658722841845
Description: locus:dylt-1 status:Confirmed UniProt:Q19416 protein_id:CAA95796.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00485800(coding)
ATGGAAGAAGTTATTTTCAACAATCTCAAAAATTAAATTAACGATAAAGCTTTATAAATT
ATTAAAGAAAAAATAGATAAAAAGTCATATAATTCTAATGATGCTCAAAGGTGGACTAAC
TAATTATGCGATGATGTTTTAAAATTTCTCACTACTTTAAATAAAAACTTTAAATTTATT
GTAAACTGCATGATCATGCAAAAAAGTGATGCAGGTTTACATATTTCTGGTTCTTGCTAT
TGGGATAATGAAATAGATGGCAGTTTGGTAGTAAAATATGAAACTAACTCAATAGTTTGT
ATCATGAATATATTTGGGTGTGCTTTGTGA


>TTHERM_00485800(gene)
ATGGAAGAAGTTATTTTCAACAATCTCAAAAATTAAATTAACGATAAAGCTTTATAAATT
ATTAAAGAAAAAATAGATAAAAAGTCATATAATTCTAATGATGCTCAAAGGTGGACTAAC
TAATTATGCGATGATGTTTTAAAATTTCTCACTACTTTAAATAAAAACTTTAAATTTATT
GTAAACTGCATGATCATGCAAAAAAGTGATGCAGGTTTACATATTTCTGGTTCTTGCTAT
TGGGATAATGAAATAGATGGCAGTTTGGTAGTAAAATATGAAACTAACTCAATAGTTTGT
ATCATGAATATATTTGGGTGTGCTTTGTGA


>TTHERM_00485800(protein)
MEEVIFNNLKNQINDKALQIIKEKIDKKSYNSNDAQRWTNQLCDDVLKFLTTLNKNFKFI
VNCMIMQKSDAGLHISGSCYWDNEIDGSLVVKYETNSIVCIMNIFGCAL