Identifiers and Description

Gene Model Identifier

TTHERM_00486070

Standard Name

CPD1 (CAP-D2 homolog 1)

Aliases

PreTt19539 | 59.m00177 | 3680.m00034 | CPDT1

Description

non-SMC mitotic condensation complex subunit 1 amine-terminal protein; Condensin subunit- HEAT repeat

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12109.1 9.997093137033517e-262
Description: hypothetical protein (1399 aa)
Oxytricha Contig17170.0.g39 7.000315720897034e-164
Description: non-SMC mitotic condensation complex subunit 1
DictyBase DDB_G0293984 1.0001478224244938e-84
Description: ncapD2 on chromosome: 6 position 3563765 to 3568484
SGD YLR272C 2.0002571866765887e-62
Description: YCS4 Subunit of the condensin complex; required for establishment and maintenance of chromosome condensation, chromosome segregation, chromatin binding of condensin, tRNA gene clustering at the nucleolus, and silencing at the mating type locus
Stentor Coeruleus SteCoe_9969 2.4426007377405277e-36
Description: None
WormBase WBGene00001087 0.00000000000001000191320216021
Description: locus:dpy-28 Condensin complex subunit 1 status:Confirmed UniProt:Q9U2M1 protein_id:CAA16340.3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478

Sequences

>TTHERM_00486070(coding)
ATGACTGAGTTTTTCATATTCCCATTCAGCTTCTCTGAGATCAGAGAACAGTCATCAGAC
AGTAGATATACTGTCGTTGGTGGAAATTTCGTAAAAGGTTAGGAAGAGAAGTAAATAAAA
AGGACCCTTAATGAACTAGATAGAGCAATTTACGAAGATATTCATATTATAAATGAAAGC
GACAGATTTGATTATTTATATTGGATTATTACTATGATGGAAGAAAGTAAAGAGAAGATG
AATGTAGAAATCCTAGTAAAAGTTGGAGATATAATACACACTCATTTCTAGCGCATTATT
AAAATGCTTGACGATGTTGATGGAGAAGATTAAATCAACTAACATAGAATCTCATTTAAA
ATGCTGGCATTCTTAGCTTTTTACTATCTGAATGCAAGTTGTGTTAAAAAGCCAAAAAAG
GCTTTAATTTCAAATGAAATAAGAGGAAAAAAAGAGGTTTCTAATGAGTATATTGAGAAA
ATAGCTGAAAAGCAAGCTATTTTATTAAGGTTATTTGAAGAATCTCTTTTAATTAATTTT
AAAACGCTTTGGTAAAGAAGAGAAATTGATTCACAGTTTTTCAAATACTATTATGAGACA
TCCTTGAAAATGCTTGAAAGCAAGCAATTATTAAAATAGCAAAATATTAAAGAAACCATA
TTTAACATTTTGAAGAAGGTTATTTTTATAAACTCTGATAGCTTGAGCACTATATAATTT
AAATTGATCAATTTAATTTATGAAGAAGAAAACATAGTTGAATATATTTGCGATTTTTTA
TTATCAACATAAAATTAAAACAGTGGCAATACCAACCAAGATGAATTTTTAATTCTTTTG
AATATTAGTGAAGATTAAAGGGATAATAGCGAGAAGAACTATTCTCAACTTTGCACAGAT
ACTCTCATTCGTTTAGTAAATTATGCAAATTAAACTAATGTAAATACTGAATCATAAGCA
GTCAAGAATGTCAAAGAATTCTTATTAAAAATGTCTGAAAAGATTCCTAAAATATTTTAC
AACAATTTATCTTGCTTTGTCTAACTCCTAGATAATGAAGCTTACCATTTAAGAAATGCA
GTAGTAGAAATAATGGGTAACATTATTAAAAATGTTCTGTCAACTCGTTAAAATCTTCCT
TAGGATGAGTAAAGTCTCTAAGAAGAAGAGAGTGAAAACCATGAAAAAGCAAAAGAAAAG
ATACTTGATGCGTTGATTTAAAGAATATATGACAAGCATGCTTTTTCAAGATCACATGTT
TTATAAGTTTTTATAGATTTATGCACTTAAAATCTTATTCCTCAAAATTACCTTTTCCCA
TTATTAGGATGTGCTTGTGATAGAATAAAAGATACATCTGCTAATGTTCGTAAGAAAGCC
ATCATCCTATTGCTTAAAATTATGGAATTTTACTTCATCATATTTGCAGCTTCTTAAAAT
AGAGTTAAATTCCATACTATAGAAGAGCTTGAAAGAGAACAAAGTTTCAATGAAACTGAA
AAATCAGAACTCATTTCAGAATAAAAATAAATAGAAGAAAAATTATAAGACAGAGAAAAC
GTAGAATAATTTCACGAATTTTAGCACGACTTAAATTAAGTTAAGAGAAAAATAGAATTA
TGCATGAAGTTAAAGCATAATTTGGATGAATATACAAAAATGATTAACTAAATTGAATTG
ATTATGCCAAATCTCTTATAATTACTGGGTTCCAAAAATAACTCAGATGTTACAGAAACC
ATTAAATTAATGATTTATTTATATTAAACAAATATTCAATGTGCTAATCAAGGAATTAGA
AAGATGCTCGTCTTAATATGGTCAAGAGAAAAGCTAGTAAAAGAAGAGCTCATTAAAGCT
TATTGGATTCTATATTTAGATGAAAAGGCATTCAAGCCAGAAGGAGTAGCTAAAAATTTA
GTTTATTTGTTTAAAAAAGCAAATCTAACAGATTTAACCTCATTAGAAGAATTGCTGGTT
GCAATACAAAAATGGAATCAAACAATCGAAGAGAAAGAAAGAGAAAAGAAACAAGATATG
TTTTACATAAGCAATAAAACATTCGATAAAATTTGGGATATATTCACAACTTCTGTCATT
TAAAACGATGCTAATTCTAAATATTCTATGAGAGCTGCTCTAACTATCCTCCGTATAAGT
TCTTAAAATAACAAGGTTATATTCACATAAAATAGAATGATTTCTCTAATTGAAGTTTTG
AAAAAATTCTTAAGGTTAAATTAACCTGATTGGATAGTAGTCAAAGAGATAGGCATTTTA
CTTGAAAATAAAGAGGATTGCAATTATTTAAATAGCTTCATAAAGCTCATGATTTTTATA
CTTATCAAATTTTAAGGTACTGTTGATAATGAGTGGTATTGTGCTTGTGAACAAATATTA
AATACAATCTTTTCAATAGAATAAAATCCTGAGAGTCTTATCAAGTATCTCATTCTTAGA
TGTACAAAAACTCTATTGGAAGGATAAGATACAAACAGCGATATCAATAAAAATATTGAA
ATTCCTTAAACTCCTCCAAGAAATATTGTTGAAGCTGTAAGTCCTTTAAAAGTTACACCC
TTTTAAAGTCCTAAGTAAACTTTTGAAACAGAAGAAAATGAAGAAAGCAAGCAGCTGTTA
TTCGAAAGAAGACTTGGTCATTTGTTGTTCCTTGTTGGACATTGCGCACTTAAATTGCTT
ATTCATATTGATAATATTGAAAACGAACTCAAAAAGCTAAAAATTGAAGGAGAAAAAAAA
TAAGAGGAACAACAGCACAAAGATGGAGCTGAAGCTGCTGAATTAGATAAGATTTATGGT
GGTTTAGAAGCTGAATACGAAAAGAGATTAGAGTATCTTCATAAAATAGCTGAAGAAAAT
ATTATAAATGGAGATAATTTGATAGCACAATATAAACCTTGGGTAGACAAGATTGTCAAA
GATATTATTGAAAACTAAGAAGGTGCAGACTACAGAAATGTTGATTTAGACAGAGTTGCT
GTTCTTACTTTATGTAAATTCATGTGCGTATCAAAAGTATACTGTGAATAGAATCTCCCT
ATCTTATTTAAATTACTGGAATCCTCTTTTTCAGACCATCTGCTAAAGATCAATATTATA
GTATCAATTGGAGATTTGCTTCACAAATATCCTAATCTTGTTGAACCTTATAATTCAAAG
ATTTTTGCAAAATTGCATGATCCAGATGTTTAAGTTAGAAAAACAACTATGATGGTATTG
ACTCATCTTATTTTAAATGATATGATGAAAATTAGAGGTGAAATATGTGAAGTAGCTCTC
CTTTTAGAAGATGAAGAGCCTAAGATTTAAAACATTGTCAAATTATTCTTGCATGAACTC
CACAAGAAAGATTAAAAAATTATTTATAATCTTTTACCTGAAGCTATTGGCAGAATGTCT
CGTTAAGATAAAACAGAACTAGGAGCTCCTATACATGAAAAAACTTTTGAAAATTTTGCA
AAAAATATTATGCAATATTTAGAAAAAGATAAATATTCAGAAACCCTTGTTGAAAAGCTT
TGTGTCCGTTTCCAAAATTCATAAAACTAAAGAGAATGGAGAAATTGTAGCTTCTGTCTT
AGTTAGCTTAGTTATAACGAGAAAGGTTTAAGAAAATTAATTGAATTCTATGAAAATTAC
AGAGAAAAGCTTCATGACCAAGAAATTATGGAAAATTTCTAAAATATTCTCATCAAGTTA
AAGAGATTACCAAAGCAAGAAATGAAACCTTTAATTGAAGAATTTGAAGCAAAGCTTTAA
GCTTATAAGGTTGAATCATTTGAACCTGTTAAGAAAAAAGAAACTGCTTTAGCAGCTAAG
GCTAAGCGTGTTGCTGACAAAAAGAAAAAAGATGAGAGCAATAAAGAAAATTAATAAAAT
TAAATAAATACTAGAACAAAAAGCAAAAAATAAACTAAGAAAAACTAAGAAGAAAGTGAT
GAAGATGAGCTCGAAGGAGAAGATAAAAATGAAGACTTCGAAGAGGAGGAAGAAGAAATC
GAAGAAAAACCTTAAACAAATAAAAGATTTTAGAAAAAAGAGCAACCTAAAAAGAGAGTC
TTAAGAAAGACTAATTTAAATAAAAAGAGATCAATGGTAGAAGAAGATGAAGATGATGAA
TAAATGGATAGTGAAGGAGATTATGATGAAGATGATGAAGATTATAACTGA


>TTHERM_00486070(gene)
ATGACTGAGTTTTTCATATTCCCATTCAGCTTCTCTGAGATCAGAGAACAGTCATCAGAC
AGTAGATATACTGTAAATTATTTTAAACTTCAATTCCAATTATAGATTTTTAATAAATTC
ATTTTATAGATCTTGTATGAGATTATTAAAATTTTGAATATTTCTGATAGGTCGTTGGTG
GAAATTTCGTAAAAGGTTAGGAAGAGAAGTAAATAAAAAGGACCCTTAATGAACTAGATA
GAGCAATTTACGAAGATATTCATATTATAAATGAAAGCGACAGATTTGATTATTTATATT
GGATTATTACGTAATTATTCTACTAATTTTATATTTAAAAAATGAACTTTAGAGCATTCA
TTAACGTTTTTATGATGATCTAATAGTATGATGGAAGAAAGTAAAGAGAAGATGAATGTA
GAAATCCTAGTAAAAGTTGGAGATATAATACACACTCATTTCTAGCGCATTATTAAAATG
CTTGACGATGTTGATGGAGAAGATTAAATCAACTAACATAGAATCTCATTTAAAATGCTG
GCATTCTTAGCTTTTTACTATCTGAATGCAAGTTGTGTTAAAAAGCCAAAAAAGGCTTTA
ATTTCAAATGAAATAAGAGGAAAAAAAGAGGTTTCTAATGAGTATATTGAGAAAATAGCT
GAAAAGCAAGCTATTTTATTAAGGTTATTTGAAGAATCTCTTTTAATTAATTTTAAAACG
CTTTGGTAAAGAGTAAATAAAATCTTTTTTAACTTTTTCTTTTTATGATGATAATTTATG
TATATATCAATCATTTATTTAAAATATTTTTATTCTAGTTTTTTATGTTTCAAGAATATC
TTTTCATTAATCATAAATTTAAAATAGAGAGAAATTGATTCACAGTTTTTCAAATACTAT
TATGAGACATCCTTGAAAATGCTTGAAAGCAAGCAATTATTAAAATAGCAAAATATTAAA
GAAACCATATTTAACATTTTGAAGAAGGTTATTTTTATAAACTCTGATAGCTTGAGCACT
ATATAATTTAAATTGATCAATTTAATTTATGAAGAAGAAAACATAGTTGAATATATTTGC
GATTTTTTATTATCAACATAAAATTAAAACAGTGGCAATACCAACCAAGATGAATTTTTA
ATTCTTTTGAATATTAGTGAAGATTAAAGGGATAATAGCGAGAAGAACTATTCTCAACTT
TGCACAGATACTCTCATTCGTTTAGTAAATTATGCAAATTAAACTAATGTAAATACTGAA
TCATAAGCAGTCAAGAATGTCAAAGAATTCTTATTAAAAATGTCTGAAAAGATTCCTAAA
ATATTTTACAACAATTTATCTTGCTTTGTCTAACTCCTAGATAATGAAGCTTACCATTTA
AGAAATGCAGTAGTAGAAATAATGGGTAACATTATTAAAAATGTTCTGTCAACTCGTTAA
AATCTTCCTTAGGATGAGTAAAGTCTCTAAGAAGAAGAGAGTGAAAACCATGAAAAAGCA
AAAGAAAAGATACTTGATGCGTTGATTTAAAGAATATATGACAAGCATGCTTTTTCAAGA
TCACATGTTTTATAAGTTTTTATAGATTTATGCACTTAAAATCTTATTCCTCAAAATTAC
CTTTTCCCATTATTAGGATGTGCTTGTGATAGAATAAAAGATACATCTGCTAATGTTCGT
AAGAAAGCCATCATCCTATTGCTTAAAATTATGGAATTTTACTTCATCATATTTGCAGCT
TCTTAAAATAGAGTTAAATTCCATACTATAGAAGAGCTTGAAAGAGAACAAAGTTTCAAT
GAAACTGAAAAATCAGAACTCATTTCAGAATAAAAATAAATAGAAGAAAAATTATAAGAC
AGGTAAAATATTTTTATTAAGTTAAAATTCAAGTTTGCATTCATTTTTTAATAAAAATTA
ATAAATTTTTATTATTTTAAATAGAGAAAACGTAGAATAATTTCACGAATTTTAGCACGA
CTTAAATTAAGTTAAGAGAAAAATAGAATTATGCATGAAGTTAAAGCATAATTTGGATGA
ATATACAAAAATGATTAACTAAATTGAATTGATTATGCCAAATCTCTTATAATTACTGGG
TTCCAAAAATAACTCAGATGTTACAGAAACCATTAAATTAATGATTTATTTATATTAAAC
AAATATTCAATGTGCTAATCAAGGAATTAGAAAGATGCTCGTCTTAATATGGTCAAGAGA
AAAGCTAGTAAAAGAAGAGCTCATTAAAGCTTATTGGGTAAAATAAACAATTTATTATCA
ATAAAAAAATATATTTAATTTATTTATTTATAATAAAAAATTAGATTCTATATTTAGATG
AAAAGGCATTCAAGCCAGAAGGAGTAGCTAAAAATTTAGTTTATTTGTTTAAAAAAGCAA
ATCTAACAGATTTAACCTCATTAGAAGAATTGCTGGTTGCAATACAAAAATGGAATCAAA
CAATCGAAGAGAAAGAAAGAGAAAAGAAACAAGATATGTTTTACATAAGCAATAAAACAT
TCGATAAAATTTGGGATATATTCACAACTTCTGTCATTTAAAACGATGCTAATTCTAAAT
ATTCTATGAGAGCTGCTCTAACTATCCTCCGTATAAGTTCTTAAAATAACAAGGTTATAT
TCACATAAAATAGAATGATTTCTCTAATTGAAGTTTTGAAAAAATTCTTAAGGTTAAATT
AACCTGATTGGATAGTAGTCAAAGAGATAGGTACAATTTAATTTTGAAATGCATTCATTT
ATTTTAATATTTTTTCATTATATAGGCATTTTACTTGAAAATAAAGAGGATTGCAATTAT
TTAAATAGCTTCATAAAGCTCATGATTTTTATACTTATCAAATTTTAAGGTACTGTTGAT
AATGAGTGGTATTGTGCTTGTGAACAAATATTAAATACAATCTTTTCAATAGAATAAAAT
CCTGAGAGTCTTATCAAGTATCTCATTCTTAGATGTACAAAAACTCTATTGGAAGGATAA
GATACAAACAGCGATATCAATAAAAATATTGAAATTCCTTAAACTCCTCCAAGAAGTAAG
TATATCCTTTAATTACTTAAAATTCAAAATTTAAAATAATTTTAAAAGATATTGTTGAAG
CTGTAAGTCCTTTAAAAGTTACACCCTTTTAAAGTCCTAAGTAAACTTTTGAAACAGAAG
AAAATGAAGAAAGCAAGCAGCTGTTATTCGAAAGAAGACTTGGTCATTTGTTGTTCCTTG
TATACAATTTATATAATAAAATTAATAAAAAATTAAAAAAATATAATTTTATCTAAATAA
TAGGTTGGACATTGCGCACTTAAATTGCTTATTCATATTGATAATATTGAAAACGAACTC
AAAAAGCTAAAAATTGAAGGAGAAAAAAAATAAGAGGAACAACAGCACAAAGATGGAGCT
GAAGCTGCTGAATTAGATAAGATTTATGGTGGTTTAGAAGCTGAATACGAAAAGAGATTA
GAGTATCTTCATAAAATAGCTGAAGAAAATATTATAAATGGAGATAATTTGATAGCACAA
TATAAACCTTGGGTAGACAAGATTGTCAAAGATATTATTGAAAACTAAGAAGGTGCAGAC
TACAGAAATGTTGATTTAGACAGAGTTGCTGTTCTTACTTTATGTAAATTCATGTGCGTA
TCAAAAGTATACTGTGAATAGAATCTCCCTATCTTATTTAAATTACTGGAATCCTCTTTT
TCAGACCATCTGCTAAAGATCAATATTATAGTATCAATTGGAGATTTGCTTCACAAATAT
CCTAATCTTGTTGAACCTTATAATTCAAAGATTTTTGCAAAGTAAATTTCCTTTTATTTT
GATTAAATTTAATATTTATCTTAAATAATAGATTGCATGATCCAGATGTTTAAGTTAGAA
AAACAACTATGATGGTATTGACTCATCTTATTTTAAATGATATGATGAAAATTAGAGGTG
AAATATGTGAAGTAGCTCTCCTTTTAGAAGATGAAGAGCCTAAGATTTAAAACATTGTCA
AATTATTCTTGCATGAACTCCACAAGAAAGATTAAAAAATTATTTATAATCTTTTACCTG
AAGCTATTGGCAGAATGTCTCGTTAAGATAAAACAGAACTAGGAGCTCCTATACATGAAA
AAACTTTTGAAAATTTTGCAAAAAATATTATGCAATATTTAGAAAAAGATAAATATTCAG
AAACCCTTGTTGAAAAGCTTTGTGTCCGTTTCCAAAATTCATAAAGTAATTAATTTATTT
ATTGATTTTTAACTATAATAAATAACTTACGTTAATAAAGACTAAAGAGAATGGAGAAAT
TGTAGCTTCTGTCTTAGTTAGCTTAGTTATAACGAGAAAGGTTTAAGAAAATTAATTGAA
TTCTATGAAAATTACAGAGAAAAGCTTCATGACCAAGAAATTATGGAAAATTTCTAAAAT
ATTCTCATCAAGTTAAAGAGATTACCAAAGCAAGAAATGAAACCTTTAATTGAAGAATTT
GAAGCAAAGCTTTAAGCTTATAAGGTTGAATCATTTGAACCTGTTAAGAAAAAAGAAACT
GCTTTAGCAGCTAAGGCTAAGCGTGTTGCTGACAAAAAGAAAAAAGATGAGAGCAATAAA
GAAAATTAATAAAATTAAATAAATACTAGAACAAAAAGCAAAAAATAAACTAAGAAAGTA
AAAATTATTTACAAAAAATATATTATTTAAATAAATAAATTTTAAATAAGAACTAAGAAG
AAAGTGATGAAGATGAGCTCGAAGGAGAAGATAAAAATGAAGACTTCGAAGAGGAGGAAG
AAGAAATCGAAGAAAAACCTTAAACAAATAAAAGATTTTAGAAAAAAGAGCAACCTAAAA
AGAGAGTCTTAAGAAAGACTAATTTAAATAAAAAGAGATCAATGGTAGAAGAAGATGAAG
ATGATGAATAAATGGATAGTGAAGGAGATTATGATGAAGATGATGAAGATTATAACTGA


>TTHERM_00486070(protein)
MTEFFIFPFSFSEIREQSSDSRYTVVGGNFVKGQEEKQIKRTLNELDRAIYEDIHIINES
DRFDYLYWIITMMEESKEKMNVEILVKVGDIIHTHFQRIIKMLDDVDGEDQINQHRISFK
MLAFLAFYYLNASCVKKPKKALISNEIRGKKEVSNEYIEKIAEKQAILLRLFEESLLINF
KTLWQRREIDSQFFKYYYETSLKMLESKQLLKQQNIKETIFNILKKVIFINSDSLSTIQF
KLINLIYEEENIVEYICDFLLSTQNQNSGNTNQDEFLILLNISEDQRDNSEKNYSQLCTD
TLIRLVNYANQTNVNTESQAVKNVKEFLLKMSEKIPKIFYNNLSCFVQLLDNEAYHLRNA
VVEIMGNIIKNVLSTRQNLPQDEQSLQEEESENHEKAKEKILDALIQRIYDKHAFSRSHV
LQVFIDLCTQNLIPQNYLFPLLGCACDRIKDTSANVRKKAIILLLKIMEFYFIIFAASQN
RVKFHTIEELEREQSFNETEKSELISEQKQIEEKLQDRENVEQFHEFQHDLNQVKRKIEL
CMKLKHNLDEYTKMINQIELIMPNLLQLLGSKNNSDVTETIKLMIYLYQTNIQCANQGIR
KMLVLIWSREKLVKEELIKAYWILYLDEKAFKPEGVAKNLVYLFKKANLTDLTSLEELLV
AIQKWNQTIEEKEREKKQDMFYISNKTFDKIWDIFTTSVIQNDANSKYSMRAALTILRIS
SQNNKVIFTQNRMISLIEVLKKFLRLNQPDWIVVKEIGILLENKEDCNYLNSFIKLMIFI
LIKFQGTVDNEWYCACEQILNTIFSIEQNPESLIKYLILRCTKTLLEGQDTNSDINKNIE
IPQTPPRNIVEAVSPLKVTPFQSPKQTFETEENEESKQLLFERRLGHLLFLVGHCALKLL
IHIDNIENELKKLKIEGEKKQEEQQHKDGAEAAELDKIYGGLEAEYEKRLEYLHKIAEEN
IINGDNLIAQYKPWVDKIVKDIIENQEGADYRNVDLDRVAVLTLCKFMCVSKVYCEQNLP
ILFKLLESSFSDHLLKINIIVSIGDLLHKYPNLVEPYNSKIFAKLHDPDVQVRKTTMMVL
THLILNDMMKIRGEICEVALLLEDEEPKIQNIVKLFLHELHKKDQKIIYNLLPEAIGRMS
RQDKTELGAPIHEKTFENFAKNIMQYLEKDKYSETLVEKLCVRFQNSQNQREWRNCSFCL
SQLSYNEKGLRKLIEFYENYREKLHDQEIMENFQNILIKLKRLPKQEMKPLIEEFEAKLQ
AYKVESFEPVKKKETALAAKAKRVADKKKKDESNKENQQNQINTRTKSKKQTKKNQEESD
EDELEGEDKNEDFEEEEEEIEEKPQTNKRFQKKEQPKKRVLRKTNLNKKRSMVEEDEDDE
QMDSEGDYDEDDEDYN