Identifiers and Description

Gene Model Identifier

TTHERM_00486410

Standard Name

MRNC30 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt19572 | 59.m00210 | 3680.m00067

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12140.1 9.997093137033517e-262
Description: hypothetical protein (449 aa)
Oxytricha Contig7961.0.g38 8.999890565246037e-26
Description: MORN repeat
WormBase WBGene00002179 0.000000000029994712494008525
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2
Stentor Coeruleus SteCoe_6139 0.00000000003775134544279098
Description: None
DictyBase DDB_G0288227 0.0000000020002373268528243
Description: DDB_G0288227 on chromosome: 5 position 1280700 to 1282179

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00486410(coding)
ATGTTTTTATTATTTTTAAAATAAATTTAATAAGTTGGTTTTATTTTTTTGGTTTGCCTG
AAAACAAAAAATTAGTTAATAAATTTAAGTTTTCTGTTATAAAATATGAAGGGAAAATAG
CAGAAAGAAGCAGAAGTTTTTTTTACTGAAAAAATAAAGCAAAACCATGAAAATGTAAAC
TCAACACTTTGTTAATACTTGTCAGAAATCAAATAAAATTTAATAGTTTATCTTTTGTGG
ATAATAAAATATCATAAATTATCATAAGAATAATTTTTCTTTTAATAATTTGTTATTATT
ATTATTAATAAATTAATATTTGATTTTATAAAGCACCAAAAAATTAGCATGGACGATACT
GAATAAAAGCTAACAGAATTTTTCAAAAATAAGCATTGCATATGGCATACAAAGAAAAGA
CCAACTTTAGTTTGTTTAGATTATTTTTGTGAAAATAAAGGACTTATATGTGCAAGCTGC
TTAACTATAAAAGGAAATCATAAAGGACATGACAGTTTAGAACTAGGTGAATTTTTAGAT
TAGATTAATGATAAATTTTCTTCTGCTGCAGAAATGGATAAAAAATTTTAATAGGAAAGT
GACTTTCATTTAAAATAGAATATTGATTCAATTCGGTCATTTTAAAAGAAATTAAATGAC
TTGATTGATTCGTATGTTGAGCAAAGGGTAAAAAGACACTAGGCTAAAATGAATGAGTTG
AATACAAGCCAACTAATTCAAAAATGCAAACAAGCAGATTTTAAGACACTAGAAGAGTTT
AATTCTGCAATTAAGCATCTTAGCACCAAGCTAAAGTACAAAAACGATTCATCTCTGCAA
AGTATTGAAGCAGACTCATCTAACTAAACAATAGAATAATAATTGCAATAGGTTTATTTG
GAAGATTTCGATGCACATATGCAGATTATTGAAAAATATTTAAATAAAGATATTCTTCCC
TACCTCGAATAAAAGGTTTTCAATTTAGATTGCTTGCGCTCTCCGAAGTATTATTTCTAA
CCATTTTATTTGCAGGAAAGTAATTTATCTATAGAAATGCTGAATAATAATAAAACAAAT
GATGGAAAGTCTACTTACAAAGGATTCTATGAAAACTAAGAAATAATTTATATAGGTGAA
CTTTAAGCCACTTTACCACATGGAAAGGGACTTTGCTATTTTAGACATACAGGTAAAATA
TATGAGGGAGAATTCCTGCAAGGAAAACTTCATGGTAAAGGCAGAATAATATTTTAAAAT
GGCGATACTTATATTGGCGATTTTCATTTAGATAAAAAGTAAGGAAGAGGAATTTATGTA
TGGACTTAGAAAGGTAATTATTACGAAGGAGAATTCTGGAATTCAAAAAGGCATGGACAG
GGATTATTTATCAGCTCTGATGGTAGCTAATATGAAGGTAACTTTAAAGATGGTGTTTAA
AGTGGTTATGGTACACTTAAAAAGAAAAATGGAGAAATAGAATATGAAGGGTAGTGGAGC
AATGGTTGCTTTGAAGGAAAAGGAATACAGTATTTAGAAAATGGTGATAAGTATAACGGT
GAATTTTCCTAAGATATGTTTAATGGACGTGGAGTTTATACTAAAAAAATAGATAATACA
GAAATTCATGGAATATGGAAAAACAACCAGCTTGTAGTAGTTAATTAGACAATATCTAGA
AACTAACAAGAAAATTGA


>TTHERM_00486410(gene)
ATGTTTTTATTATTTTTAAAATAAATTTAATAAGTTGGTTTTATTTTTTTGGTTTGCCTG
AAAACAAAAAATTAGTTAATAAATTTAAGTTTTCTGTTATAAAATATGAAGGGAAAATAG
CAGAAAGAAGCAGAAGTTTTTTTTACTGAAAAAATAAAGCAAAACCATGAAAATGTAAAC
TCAACACTTTGTTAATACTTGTCAGAAATCAAATAAAATTTAATAGTTTATCTTTTGTGG
ATAATAAAATATCATAAATTATCATAAGAATAATTTTTCTTTTAATAATTTGTTATTATT
ATTATTAATAAATTAATATTTGATTTTATAAAGCACCAAAAAATTAGCATGGACGATACT
GAATAAAAGCTAACAGAATTTTTCAAAAATAAGCATTGCATATGGCATACAAAGAAAAGA
CCAACTTTAGTTTGTTTAGATTATTTTTGTGAAAATAAAGGACTTATATGTGCAAGCTGC
TTAACTATAAAAGGAAATCATAAAGGACATGACAGTTTAGAACTAGGTGAATTTTTAGAT
TAGATTAATGATAAATTTTCTTCTGCTGCAGAAATGGATAAAAAATTTTAATAGGAAAGT
GACTTTCATTTAAAATAGAATATTGATTCAATTCGGTCATTTTAAAAGAAATTAAATGAC
TTGATTGATTCGTATGTTGAGCAAAGGGTAAAAAGACACTAGGCTAAAATGAATGAGTTG
AATACAAGCCAACTAATTCAAAAATGCAAACAAGCAGATTTTAAGACACTAGAAGAGTTT
AATTCTGCAATTAAGCATCTTAGCACCAAGCTAAAGTACAAAAACGATTCATCTCTGCAA
AGTATTGAAGCAGACTCATCTAACTAAACAATAGAATAATAATTGCAATAGGTTTATTTG
GAAGATTTCGATGCACATATGCAGATTATTGAAAAATATTTAAATAAAGATATTCTTCCC
TACCTCGAATAAAAGGTTTTCAATTTAGATTGCTTGCGCTCTCCGAAGTATTATTTCTAA
CCATTTTATTTGCAGGAAAGTAATTTATCTATAGAAATGCTGAATAATAATAAAACAAAT
GATGGAAAGTCTACTTACAAAGGATTCTATGAAAACTAAGAAATAATTTATATAGGTGAA
CTTTAAGCCACTTTACCACATGGAAAGGGACTTTGCTATTTTAGACATACAGGTAAAATA
TATGAGGGAGAATTCCTGCAAGGAAAACTTCATGGTAAAGGCAGAATAATATTTTAAAAT
GGCGATACTTATATTGGCGATTTTCATTTAGATAAAAAGTAAGGAAGAGGAATTTATGTA
TGGACTTAGAAAGGTATTTATTTATTAATTAATTAATTTAACTTCTCTTTTTTAATTGAT
CTTCTAAAGATTTTTTAAATTTGATGAAATTTCAAATATTTATTTATTATTTAACGATGA
AAGGTAATTATTACGAAGGAGAATTCTGGAATTCAAAAAGGCATGGACAGGGATTATTTA
TCAGCTCTGATGGTAGCTAATATGAAGGTAACTTTAAAGATGGTGTTTAAAGTGGTTATG
GTACACTTAAAAAGAAAAATGGAGAAATAGAATATGAAGGGTAGTGGAGCAATGGTTGCT
TTGAAGGAAAAGGAATACAGTATTTAGAAAATGGTGATAAGTATAACGGTGAATTTTCCT
AAGATATGTTTAATGGACGTGGAGTTTATACTAAAAAAATAGATAATACAGAAATTCATG
GAATATGGAAAAACAACCAGCTTGTAGTAGTTAATTAGACAATATCTAGAAACTAACAAG
AAAATTGA


>TTHERM_00486410(protein)
MFLLFLKQIQQVGFIFLVCLKTKNQLINLSFLLQNMKGKQQKEAEVFFTEKIKQNHENVN
STLCQYLSEIKQNLIVYLLWIIKYHKLSQEQFFFQQFVIIIINKLIFDFIKHQKISMDDT
EQKLTEFFKNKHCIWHTKKRPTLVCLDYFCENKGLICASCLTIKGNHKGHDSLELGEFLD
QINDKFSSAAEMDKKFQQESDFHLKQNIDSIRSFQKKLNDLIDSYVEQRVKRHQAKMNEL
NTSQLIQKCKQADFKTLEEFNSAIKHLSTKLKYKNDSSLQSIEADSSNQTIEQQLQQVYL
EDFDAHMQIIEKYLNKDILPYLEQKVFNLDCLRSPKYYFQPFYLQESNLSIEMLNNNKTN
DGKSTYKGFYENQEIIYIGELQATLPHGKGLCYFRHTGKIYEGEFLQGKLHGKGRIIFQN
GDTYIGDFHLDKKQGRGIYVWTQKGNYYEGEFWNSKRHGQGLFISSDGSQYEGNFKDGVQ
SGYGTLKKKNGEIEYEGQWSNGCFEGKGIQYLENGDKYNGEFSQDMFNGRGVYTKKIDNT
EIHGIWKNNQLVVVNQTISRNQQEN