Identifiers and Description

Gene Model Identifier

TTHERM_00487020

Standard Name

PRS1 (Prolyl-tRNA synthetase 1)

Aliases

PreTt19633 | 59.m00271 | 3680.m00128

Description

PRS1 prolyl-tRNA synthetase protein putative; prolyl-tRNA synthetase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00587 ) tRNA synthetase class II core
  • ( PF03129 ) Anticodon binding domain
  • ( PF04073 ) YbaK/prolyl-tRNA synthetases associated domain
  • ( PF05727 ) Uncharacterised protein family (UPF0228)
  • ( PF09180 ) Prolyl-tRNA synthetase, C-terminal
  • ( TIGR00408 ) prolyl-tRNA synthetase
  • ( TIGR00409 ) prolyl-tRNA synthetase
  • ( TIGR00414 ) seryl-tRNA synthetase
  • ( TIGR00418 ) threonyl-tRNA synthetase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_37784 0
Description: None
WormBase WBGene00004189 9.997093137033517e-262
Description: locus:pars-1 status:Confirmed UniProt:Q22620 protein_id:CCD73349.1
Tetrahymena borealis EI9_12209.1 9.997093137033517e-262
Description: prolyl-tRNA synthetase (734 aa)
DictyBase DDB_G0284197 9.997093137033517e-262
Description: proS on chromosome: 4 position 1680128 to 1681774
Oxytricha Contig15844.0.g111 9.997093137033517e-262
Description: Anticodon binding domain
SGD YHR020W 9.997093137033517e-262
Description: YHR020W Protein of unknown function that may interact with ribosomes, based on co-purification experiments; has similarity to proline-tRNA ligase; YHR020W is an essential gene

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00487020(coding)
ATGATAAAAATATTAAACAGATTCGTAAGGATTCAAAAATTTAATAATAATTATTTAAAA
AATATTAATAACAATTAAAATTTCTATAGCATTCATTAAAAATATCTTAATCACTTTTCA
AGGAAAATGGCTGAGAGCAAATTATACCTCACAAAGGACGAAACTTGCGATTACTTAAAA
AGCATTAATTTCGAATTTAAGAGATACGATCACGAACCTTGCTTTAATGTTGAAGATATG
CATAAATACTTAAAGCTCGAAAAGGCTCCTTTAATTAAGAATCTCTTCTATCAAGACAAG
AAGGGTAACTATTATTTAGTTGTAGCTAAGCATGATACTAAAGTTGAAAAAACTTTATGG
AAGTAAGTCAATCTTGCTCCTGGTAACATGCGTTTAGCTGCTGATGAAAAGCTTGAGGCT
GTTTTGAAGGTCAAGAGAGGACATGTTAATCCTTTCGCCTTAGTTAATGATACTGAAAAG
TTAGTTAAAGCTTTAATTATCGATGAACATTTGAAGAAAGAAGAATATTGGGCTTTCCAT
CCTATGGATAATTCTGCTTGCGTTGAATTCAAGCAAACTGAATTCTAAAAGTTTATCGAT
GCTATTGGCAGAACTTTTGTTCACGTGAGACTCGACTTATCTGAAGAAGAAGAGAAAAAG
CTCGCAGAATAAGCAAAGAAGGAAACTGCTAAAGTTGAAGAAGCTGGTCATACTAAATTA
GGTATTGATGTTAAAAAAGATCAAGATTTATCTGAATGGTACAAGCAAGTTATCACTAAA
TCTGAAATGATCGAATATTATGATATCTCTGGTTGCTACATTCTTCGTCCCCACGCTTAT
GCCATCTGGGAAATCATTTAGAGATTCTTTGATGACATCATCAAGGGATTCGATGTACAA
AATGCTTATTTCCCTATGTTTGTCACTGATAAGGCTTTAAACAAAGAAAAGGAACACGTT
GAAGGTTTCTCACCTGAAGTTGCTTGGGTTACTAGAAGTGGTTCCACTGATTTACCTGAA
CCTATTGCAGTTCGTCCTACATCAGAAACAATTATGTATCCTGCTTACTCCAAGTGGATC
AAGTCTCACAGAGATCTTCCCTTGAAATTAAACTAATGGACTAACGTAGTCCGTTGGGAA
TTCAAGGATCCTACTCCTTTCATTAGAACAAGAGAATTCTTATGGTAAGAAGGTCACACC
GCTCATGCCACTGATGCTGAAGCCACTGAATTTACTTTCCTTATCTAAGATTAATACAGA
AGAGTCTACGAAGAACTCCTTGCTGTTCCTGTTATCAAGGGTGTCAAGAGTGAAAATGAA
AAATTCCCTGGTGCTTACTTCTCTTCCACTATTGAAACTTGCATTCCTGCTAATGGTCGT
GCTGTCTAAGCTGCCACTTCTCACCACTTGGGATAAAACTTCTCAAAGATGTTTGATATT
TCCTTCTTAGATGGTGAAAAAAAGAAATAATACGCCTACCAAACTTCCTGGGGTCTTACT
ACTCGTACTATTGGTGTTATGATTCTTTATCACGGTGATGATAAGGGTCTTGTTTTACCT
CCTCTTGTTGCTAGCACTCAAGTTGTTATCGTTCCAATTATTAAAACCGGAGCTGATAAC
GAAAGAGTTTTAAACAAAGCTCATGAATTAAAGGCTGAATTAAAGAAGGCTGGTATCAGA
GTTTAGGTTGATGACAGAGATAACTATACTTCTGGTTGGAAATTCAACCATTGGGAAGTC
AAGGGTATTCCTTTAAGATTTGAAATTGGTCAAATGGATATGGATAAGAATTAAATTACA
GCAGTTTGGAGAGTCAACTCTCACAAGGAAGCTATTCCTAACGAAAGTATTATTGAAACT
ACTAAGTTAAGATTGAAAGAAATACAAGATTTAATGTTAACTAACTCCAAGAAAAAGTTT
AACGATAAGATTAAGCCTGCTAGTACCTGGGCTGAATTCATGACTTCTCTTAACTCTCGT
TGCATTGTCTATACTCCTTGGTGCAATGAAATTTCATGTGAAAAGGCTGTTAAGGAAAGA
TCAGCTCTTGAATCTAAGGGAACAGAAAATGAATCTGGTTTATCTGGATCTGCAAAGACT
TTGTGCATTCCTAATGAATAAGAACCTATCGCTGAAGGCACTAAGTGTTTCTCTTGCGGA
AAGCCTGCTCTTAAGAGAGTTTATTGGGGAAGATCTTATTGA


>TTHERM_00487020(gene)
ATGATAAAAATATTAAACAGATTCGTAAGGATTCAAAAATTTAATAATAATTATTTAAAA
AATATTAATAACAATTAAAATTTCTATAGCATTCATTAAAAATATCTTAATCACTTTTCA
AGGAAAATGGCTGAGAGCAAATTATACCTCACAAAGGACGAAACTTGCGATTACTTAAAA
AGCATTAATTTCGAATTTAAGAGATACGATCACGAACCTTGCTTTAATGTTGAAGATATG
CATAAATACTTAAAGCTCGAAAAGGCTCCTTTAATTAAGAATCTCTTCTATCAAGACAAG
AAGGGTAACTATTATTTAGTTGTAGCTAAGCATGATACTAAAGTTGAAAAAACTTTATGG
AAGTAAGTCAATCTTGCTCCTGGTAACATGCGTTTAGCTGCTGATGAAAAGCTTGAGGCT
GTTTTGAAGGTCAAGAGAGGACATGTTAATCCTTTCGCCTTAGTTAATGATACTGAAAAG
TTAGTAGGGATAAATTCTTTAATTTCAATTCAAAAGCTCAATTTTCCATTTTAAAGTTAA
AAATTTGAATTATTATGATCAAAAAAAGATGAATGAGAATAAGCATATTATTTGCACCCA
TAAATTATCAAACACCTAATAAAAATATCAAACTTATACAATAAGTTTTTTAAAATGAGC
GAAAATAGTGTTAATAAAATCACATTGTGAATACGTAATTTAGCATAAGACTTATGAAAA
TGTATTTTTAATAAAAAGGTTAAAGCTTTAATTATCGATGAACATTTGAAGAAAGAAGAA
TATTGGGCTTTCCATCCTATGGATAATTCTGCTTGCGTTGAATTCAAGCAAACTGAATTC
TAAAAGTTTATCGATGCTATTGGCAGAACTTTTGTTCACGTGAGACTCGACTTATCTGAA
GAAGAAGAGAAAAAGCTCGCAGAATAAGCAAAGAAGGAAACTGCTAAAGTTGAAGAAGCT
GGTCATACTAAATTAGGTATTGATGTTAAAAAAGATCAAGATTTATCTGAATGGTACAAG
CAAGTTATCACTAAATCTGAAATGATCGAATATTATGATATCTCTGGTTGCTACATTCTT
CGTCCCCACGCTTATGCCATCTGGGAAATCATTTAGGTAATACATTTTACAATATTTTTA
CTACATTTAAAAAAGCTAGATCAGAAAAAAATAAAAAAGATTATTTATATATTTCTAAAC
GTTCTTCATAAAAAAATTAAATTATTGCGAAGTTAGTTAATAGTATATCTAAAATATATC
AAAAATAAATAGATATTAGTTAGTTAGTAAGCGAAAAAATAAATCTTTTTAAAAGAACGC
GAAAAAAATTGATAGAAAATTTAGATTTAATTTGTCTAATCTGAAAATTTTGAACTTTTT
TTATTTTTTTGTTAAATTTAAATTTCAATTAAAAATAATAATAATAGAGATTCTTTGATG
ACATCATCAAGGGATTCGATGTACAAAATGCTTATTTCCCTATGTTTGTCACTGATAAGG
CTTTAAACAAAGAAAAGGAACACGTTGAAGGTTTCTCACCTGAAGTTGCTTGGGTTACTA
GAAGTGGTTCCACTGATTTACCTGAACCTATTGCAGTTCGTCCTACATCAGAAACAATTA
TGTATCCTGCTTACTCCAAGTGGATCAAGTCTCACAGAGATCTTCCCTTGAAATTAAACT
AATGGACTAACGTAGTCCGTTGGGAATTCAAGGATCCTACTCCTTTCATTAGAACAAGGT
ATTTATTATAAATTAAAATGCTTTTAAATAACTATTAAATATTCTAAAATCTATAGAAAG
TTTTAATTTTTAAATTCAATATTTTATTAAAAATTAATATAAATTTATTTATTTCTTAGA
GAATTCTTATGGTAAGAAGGTCACACCGCTCATGCCACTGATGCTGAAGCCACTGAATTT
ACTTTCCTTATCTAAGATTAATACAGAAGAGTCTACGAAGAACTCCTTGCTGTTCCTGTT
ATCAAGGGTGTCAAGAGTGAAAATGAAAAATTCCCTGGTGCTTACTTCTCTTCCACTATT
GAAACTTGCATTCCTGCTAATGGTCGTGCTGTCTAAGCTGCCACTTCTCACCACTTGGGA
TAAAACTTCTCAAAGATGTTTGATATTTCCTTCTTAGATGGTGAAAAAAAGAAATAATAC
GCCTACCAAACTTCCTGGGGTCTTACTACTCGTACTATTGGTGTTATGATTCTTTATCAC
GGTGATGATAAGGTAATTTTTATTTTAAAGTTAATAAATTTACATTTAATATTTATGCAA
TTTGTAATTAGGGTCTTGTTTTACCTCCTCTTGTTGCTAGCACTCAAGTTGTTATCGTTC
CAATTATTAAAACCGGAGCTGATAACGAAAGAGTTTTAAACAAAGCTCATGAATTAAAGG
CTGAATTAAAGAAGGCTGGTATCAGAGTTTAGGTTGATGACAGAGATAACTATACTTCTG
GTTGGAAATTCAACCATTGGGAAGTCAAGGGTATTCCTTTAAGATTTGAAATTGGTCAAA
TGGATATGGATAAGAATTAAATTACAGCAGTTTGGAGAGTCAACTCTCACAAGGAAGCTA
TTCCTAACGAAAGTATTATTGAAACTACTAAGTTAAGATTGAAAGAAATACAAGATTTAA
TGTTAACTAACTCCAAGAAAAAGTTTAACGATAAGATTAAGCCTGCTAGTACCTGGGCTG
AATTCATGACTTCTCTTAACTCTCGTTGCATTGTCTATACTCCTTGGTAATTATTAAAGA
CAATAAATACAGTTTTCATTTCATATCGATTTATGAAAACTGATAATTAAATTTGAATAT
TTATTGAATTTTTCTTTTTTAATAAAAGGTGCAATGAAATTTCATGTGAAAAGGCTGTTA
AGGAAAGATCAGCTCTTGAATCTAAGGGAACAGAAAATGTAAATAAATAAATATAAAATC
AAAATCATAGAAAATATTAAAATATTTTTAAATAATAGGAATCTGGTTTATCTGGATCTG
CAAAGACTTTGTGCATTCCTAATGAATAAGAACCTATCGCTGAAGGCACTAAGTGTTTCT
CTTGCGGAAAGCCTGCTCTTAAGAGAGTTTATTGGGGAAGATCTTATTGA


>TTHERM_00487020(protein)
MIKILNRFVRIQKFNNNYLKNINNNQNFYSIHQKYLNHFSRKMAESKLYLTKDETCDYLK
SINFEFKRYDHEPCFNVEDMHKYLKLEKAPLIKNLFYQDKKGNYYLVVAKHDTKVEKTLW
KQVNLAPGNMRLAADEKLEAVLKVKRGHVNPFALVNDTEKLVKALIIDEHLKKEEYWAFH
PMDNSACVEFKQTEFQKFIDAIGRTFVHVRLDLSEEEEKKLAEQAKKETAKVEEAGHTKL
GIDVKKDQDLSEWYKQVITKSEMIEYYDISGCYILRPHAYAIWEIIQRFFDDIIKGFDVQ
NAYFPMFVTDKALNKEKEHVEGFSPEVAWVTRSGSTDLPEPIAVRPTSETIMYPAYSKWI
KSHRDLPLKLNQWTNVVRWEFKDPTPFIRTREFLWQEGHTAHATDAEATEFTFLIQDQYR
RVYEELLAVPVIKGVKSENEKFPGAYFSSTIETCIPANGRAVQAATSHHLGQNFSKMFDI
SFLDGEKKKQYAYQTSWGLTTRTIGVMILYHGDDKGLVLPPLVASTQVVIVPIIKTGADN
ERVLNKAHELKAELKKAGIRVQVDDRDNYTSGWKFNHWEVKGIPLRFEIGQMDMDKNQIT
AVWRVNSHKEAIPNESIIETTKLRLKEIQDLMLTNSKKKFNDKIKPASTWAEFMTSLNSR
CIVYTPWCNEISCEKAVKERSALESKGTENESGLSGSAKTLCIPNEQEPIAEGTKCFSCG
KPALKRVYWGRSY