Identifiers and Description

Gene Model Identifier

TTHERM_00487150

Standard Name

DIC2 (Dynein Intermediate Chain 2)

Aliases

PreTt19646 | 59.m00284 | 3680.m00141 | IC78 | IC2

Description

IC2 dynein intermediate chain 2; Intermediate chain subunit of ciliary three-headed outer arm dynein (OAD)

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_28057 0
Description: None
Tetrahymena borealis EI9_12221.1 9.997093137033517e-262
Description: hypothetical protein (668 aa)
Oxytricha Contig16948.0.0.g28 9.997093137033517e-262
Description: WD domain, G-beta repeat
DictyBase DDB_G0280849 5.999781043483669e-32
Description: dicA on chromosome: 3 position 3856978 to 3859184
WormBase WBGene00015927 2.000620012690291e-23
Description: locus:dyci-1 status:Confirmed UniProt:O45087 protein_id:CCD64991.1
SGD YDR364C 0.0000029996948234116693
Description: CDC40 Pre-mRNA splicing factor, important for catalytic step II of pre-mRNA splicing and plays a role in cell cycle progression; required for DNA synthesis during mitosis and meiosis; has WD repeats

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:9399595: Ikawa Y, Okada A, Imahori H, Shiraishi H, Inoue T (1997) Identification of the nucleotides in the A-rich bulge of the Tetrahymena ribozyme responsible for an efficient self-splicing reaction. Journal of biochemistry 122(4):878-82

Sequences

>TTHERM_00487150(coding)
ATGCCTCCAAAATAAACAAAAGTTGTAGCCAGCCGTAAGACTGTTATGCCTATTAGTAGA
GCAGGCAGAGCTTAAATCCGTAGAAAGGATTCTAACACTCAAAATAATATGAATGACTAA
GGTATGGAAGATGAGGAAATCGATCAACAAAGAGAGGGAATGAAGAACCAATACGAACAA
TTAACTGCCCAAGAATTAAATGAAGATATGCCTTCAAAAATGTTAGAGCCAAAGAACCCT
CAAGCTCCTAAAAATATCACTGTTTATGACTATTATACTCGTAAATTTAAGACTGATGAG
TTAGTCGATTAAATGATTGTTCATTTTTCTATGGATGGTGATTATATTTGGAAGGAATCA
AATGAATACAAAACTTAAGAAGAAATTCGTGATACAAAGAAAGCTTTGATCAAGGAAGCA
ATGCGTAAATAAGAAAGTGAAGAACCTGGTGCAAACCATGATGAAGAAGCAATTAAATAA
ACTCTAAGAAACAAATTTAATTACAATACACGTGAATGTTAAACAATTAATCCTTCAATA
AGAGAGCGTGGAGTTTCTACCGAACCTCCACCATCTGATACAATCTGTGGCAATATTACT
CAATGGGAAATTTTTGATGCTTATTATGCAGAAATTATGAAGGACCATCAAATTGAAAAT
AAAAAGAAGAAAGAGGTTGATTAGGATAAGAAGCAAGATTAATCTATGTACTCAACTTCG
TTCAAAAGATGTTGCAAAATTATGGAACGTATGGTTGTATAAAACGATTAGGAAGATAAG
TATCATGATTATCGTTATTATTGGAGTTAAGGCGACAACCTAGAAGCTGGTAAAAATGAA
GGTCATTTATTACCTATTTGGAGATTTAGTAATGAAAAGCAAAGAAAGAAAAATGTTACT
AGTATTTGTTGGAACCCATTATATCCAGATTTATTCGCAGTTAGTTTGGGTAGTTATGAC
TTTACTAAATAGCGTATGGGTTTAATTTGCTTATATTCTTTAAAAAACACCACACATCCA
GAATATGCCTTCAACTGTGAAGCTGGTGTTATGTGTTTAGATTTCCATCCTAAAAGTGCT
GCCCTTCTTGCTGTCGGTTTGTATGATGGTACTGTGTTAGTTTACGATATCCGTAACAAA
CACAAGAAACCTATTTATTAATCAACTGTACGTAATTAAAAGCACACAGATCCTGTCTGG
CAAGTTAAATGGAATCCAGATACTTCCAAAAATTATAATTTTTATTCCATTTCTAGTGAT
GGTAGAGTCATGAATTGGATTCTTATGAAAAATAAGTTAGAACCTGAAGAAGTTATTTTA
CTTCGTCTTGTAGGTAAGAATGAAGAGGAATCAACTTTAATCGGTTTAGCTTGTGGTCTC
TGCTTTGATTTCAATAAATTTGAACCTCATATCTTCCTTGTAGGTACAGAAGAAGGTAAA
ATTCATAAGTGTTCTCGTGCTTACTCTGGCTAGTATTAAGAAACCTACAACGGCCATCTT
CTTGCCGTCTACAAAGTTAAGTGGAATAACTTCCATCCTAGAACTTTCATTTCTGCTTCT
GCTGATTGGACTGTAAGAATTTGGGATAGTAAATACACTTCATAGATTATTTGTTTTGAT
TTATCTATGATGGTAGTCGATGCTGTCTGGGCTCCTTACTCATCAACTGTCTTTGCATGT
GCTACTATGGACAAAGTTCAAGTTTATGATTTGAACGTAGATAAACTCAATAAATTGGCA
GAACAAAAGATTGTTAAATAACCTAAGTTAACTAACTTGTCTTTCAATTATAAAGATCCT
ATCTTGTTAGTTGGTGATTCTCACGGTGGTGTTACTCTTGTCAAGCTCTCCCCTAATCTT
TGCAAAAGTGGACCTGAAATTAAATAAACTGAAGATAAAAAAGCAATGGAAGAATTTAAA
AATGTAAAAATAGAGGATTACGAAAGAGAAAAGATGGAAAATCTTCTCGCTGTAGTTAGT
AAATGGGAAAGGGAAGATGCTTGA


>TTHERM_00487150(gene)
ATGCCTCCAAAATAAACAAAAGTTGTAGCCAGCCGTAAGACTGTTATGCCTATTAGTAGA
GCAGGCAGAGCTTAAATCCGTAGAAAGGATTCTAACACTCAAAATAATATGAATGACTAA
GGTATGGAAGATGAGGAAATCGATCAACAAAGAGAGGTATATAATATATTAAATTCACTC
GTAAATTAGATGTCCTCAACAAACAAAACAAATAATACTCTAATTTAAACAAAAATATTT
TAAATATTCTATTTTTGTCTAGCAAAATTTAGAATTGAGCTAGTGTAAAATAAATAAAAA
AATGCTAGGGAAAGGCATTAAATATTGAGGATATTTAAACGAAGATACTACAGTTTAGTT
ATTAATTTAACTAAATTATTTATTTAATGAACTAAAGGGAATGAAGAACCAATACGAACA
ATTAACTGCCCAAGAATTAAATGAAGATATGCCTTCAAAAATGTTAGAGCCAAAGAACCC
TCAAGCTCCTAAAAATATCACTGTTTATGACTATTATACTCGTAAATTTAAGACTGATGA
GTTAGTCGATTAAATGATTGTTCATTTTTCTATGGATGGTGATTATATTTGGAAGGAATC
AAATGAATACAAAACTTAAGAAGAAATTCGTGATACAAAGAAAGCTTTGATCAAGGAAGC
AATGCGTAAATAAGAAAGTGAAGAACCTGGTGCAAACCATGATGAAGAAGCAATTAAATA
AACTCTAAGAAACAAATTTAATTACAATACACGTGAATGTTAAACAATTAATCCTTCAAT
AAGAGAGCGTGGAGTTTCTACCGAACCTCCACCATCTGATACAATCTGTGGCAATATTAC
TCAATGGGAAATTTTTGATGCTTATTATGCAGAAATTATGAAGGTAAAATAACTTATTCT
AAAATAGGCATATATTTTGCTTTTGAAGTAAGCTCAATCAAATTTTAATATCTTTGCAAC
GAAGATTTTACCTTCCGTTGCAAAGCAAGTGATTGAGCAAATGATCAAGCAATTAAGCTA
TATAAAATCAAAATTAGAAGTTACAATTCAATTTATTAGAAGAATGCAAGCAAATCTTTT
TATTTTTCAAAATTGATTTTAAAAAACTAAAAAAAATAAAAATTTTAAAAGATTTAAAAC
AAAAAAGTTACATTTATTTAAAGTTTCTTAAATTTTTCAACTAATATTACTTAGTAGTTT
ATAATTAAATTGGATAAACTGATATTATTATCATTAAAAATATTTAAAATTTCAAAATAT
TAACATTTTTTAAGGAAAATTTGTATCAAAAATAAAATTATTTTTTAGAAAATAAAAACT
CATACATATTAAATTTGATTATATTTCCATTACATAGCATTAAAAATATTATAATAATTT
CAATAAGGATTTTACAATTATATTAAATACAAATTTTATATTTATGTAATCAAATAGGAC
CATCAAATTGAAAATAAAAAGAAGAAAGAGGTTGATTAGGATAAGAAGCAAGATTAGTAA
ATAATTATTATTTAGTATAACTTTGATTTATATAATTATTTTTGTTTTATTTAAAATTAG
ATCTATGTACTCAACTTCGTTCAAAAGATGTTGCAAAATTATGGAACGTATGGTTGTATA
AAACGATTAGGAAGATAAGTATCATGATTATCGTTATTATTGGAGTTAAGGCGACAACCT
AGAAGCTGGTAAAAATGAAGGTAATATATACTTTTAAAAAATGAATTAAGAAAAAACTAA
GATTTTAATTTAAAAATAATATAAAAAAGGTCATTTATTACCTATTTGGAGATTTAGTAA
TGAAAAGCAAAGAAAGAAAAATGTTACTAGTATTTGTTGGAACCCATTATATCCAGATTT
ATTCGCAGTTAGTTTGGGTAGTTATGACTTTACTAAATAGCGTATGGGTTTAATTTGCTT
ATATTCTTTAAAAAACACCACACATCCAGAATATGCCTTCAACTGTGAAGCTGGTGTTAT
GTGTTTAGATTTCCATCCTAAAAGTGCTGCCCTTCTTGCTGTCGGTTTGTATGATGGTAC
TGTGTTAGTTTACGATATCCGTAACAAACACAAGAAACCTATTTATTAATCAACTGTACG
TAATTAAAAGCACACAGATCCTGTCTGGCAAGTTAAATGGAATCCAGATACTTCCAAAAA
TTATAATTTTTATTCCATTTCTAGTGATGGTAGAGTCATGAATTGGATTCTTATGAAAAA
TAAGTTAGAACCTGAAGAAGTTATTTTACTTCGTCTTGTAGGTAAGAATGAAGAGGAATC
AACTTTAATCGGTTTAGCTTGTGGTCTCTGCTTTGATTTCAATAAATTTGAACCTCATAT
CTTCCTTGTAGGTACAGAAGAAGGTAAAATTCATAAGTGTTCTCGTGCTTACTCTGGCTA
GTATTAAGAAACCTACAACGGCCATCTTCTTGCCGTCTACAAAGTTAAGTGGAATAACTT
CCATCCTAGAACTTTCATTTCTGGTAATATTATTTACTATTTATTTCACATCAAAAAATA
AAATAAAAACAAATAAGAATTGTTAAGAGTGAAAATTAAACTATTTTTTAATCTAAAATA
GCTTCTGCTGATTGGACTGTAAGAATTTGGGATAGTAAATACACTTCATAGATTATTTGT
TTTGATTTATCTATGATGGTAGTCGATGCTGTCTGGGCTCCTTACTCATCAACTGGTAAA
TAATTCAAAAATAAATCATAAAAATATAATTTGCTTATTAATAATAATAATAAATACAGT
CTTTGCATGTGCTACTATGGACAAAGTTCAAGTTTATGATTTGAACGTAGATAAACTCAA
TAAATTGGCAGAACAAAAGATTGTTAAATAACCTAAGTTAACTAACTTGTCTTTCAATTA
TAAAGATCCTATCTTGTTAGTTGGTGATTCTCACGGTGGTGTTACTCTTGTCAAGCTCTC
CCCTAATCTTTGCAAAAGTATTTAGCTTTATTATATTAAATGTAGCAATTTAAAAATTTT
TTTAATTTAGGTGGACCTGAAATTAAATAAACTGAAGATAAAAAAGCAATGGAAGAATTT
AAAAATGTAAAAATAGAGGATTACGAAAGAGAAAAGATGGAAAATCTTCTCGCTGTAGTT
AGTAAATGGGAAAGGGAAGATGCTTGA


>TTHERM_00487150(protein)
MPPKQTKVVASRKTVMPISRAGRAQIRRKDSNTQNNMNDQGMEDEEIDQQREGMKNQYEQ
LTAQELNEDMPSKMLEPKNPQAPKNITVYDYYTRKFKTDELVDQMIVHFSMDGDYIWKES
NEYKTQEEIRDTKKALIKEAMRKQESEEPGANHDEEAIKQTLRNKFNYNTRECQTINPSI
RERGVSTEPPPSDTICGNITQWEIFDAYYAEIMKDHQIENKKKKEVDQDKKQDQSMYSTS
FKRCCKIMERMVVQNDQEDKYHDYRYYWSQGDNLEAGKNEGHLLPIWRFSNEKQRKKNVT
SICWNPLYPDLFAVSLGSYDFTKQRMGLICLYSLKNTTHPEYAFNCEAGVMCLDFHPKSA
ALLAVGLYDGTVLVYDIRNKHKKPIYQSTVRNQKHTDPVWQVKWNPDTSKNYNFYSISSD
GRVMNWILMKNKLEPEEVILLRLVGKNEEESTLIGLACGLCFDFNKFEPHIFLVGTEEGK
IHKCSRAYSGQYQETYNGHLLAVYKVKWNNFHPRTFISASADWTVRIWDSKYTSQIICFD
LSMMVVDAVWAPYSSTVFACATMDKVQVYDLNVDKLNKLAEQKIVKQPKLTNLSFNYKDP
ILLVGDSHGGVTLVKLSPNLCKSGPEIKQTEDKKAMEEFKNVKIEDYEREKMENLLAVVS
KWEREDA